Report for Sequence Feature Glyma.06g310900
Feature Type: | gene_model |
Chromosome: | Gm06 |
Start: | 49493205 |
stop: | 49494016 |
Source: | JGI |
Version: | Wm82.a4.v1 |
High confidence: | yes |
|
|
Annotations for Glyma.06g310900
Gene model name correspondences to Glyma.06g310900 Gene Call Version Wm82.a4.v1
Corresponding Name | Annotation Version | Evidence | Comments |
Glyma06g46781 | Wm82.a1.v1.1 | IGC | As supplied by JGI |
Coding sequences of Glyma.06g310900
>Glyma.06g310900.1 sequence-type=CDS polypeptide=Glyma.06g310900.1.p locus=Glyma.06g310900 id=Glyma.06g310900.1.Wm82.a4.v1 annot-version=Wm82.a4.v1
ATGGATACTCCCTCTGGAATCAAGGACTCAATTCCTGCTTGGATTAAATTTGCTGTACAGGCTCCCGGTGAAATTCCATACAGCGGAATATACTATGATCCCCTAGAAGAGAACTCATGCGTTGCCCCCCTAATAGAGGACCTGAAGGTTCGATGCGAACGACGACGGAAAAATCTCCTCGGTGTAAGCAGCAATTTTGGGGGGTCATACATGCATATATCACATGATTGA
Predicted protein sequences of Glyma.06g310900
>Glyma.06g310900.1.p sequence-type=predicted peptide transcript=Glyma.06g310900.1 locus=Glyma.06g310900 id=Glyma.06g310900.1.p.Wm82.a4.v1 annot-version=Wm82.a4.v1
MDTPSGIKDSIPAWIKFAVQAPGEIPYSGIYYDPLEENSCVAPLIEDLKVRCERRRKNLLGVSSNFGGSYMHISHD*