SoyBase Follow us on Twitter @SoyBaseDatabase
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma20g29250

Feature Type:gene_model
Chromosome:Gm20
Start:38156770
stop:38163260
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma20g29250
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G24260AT Annotation by Michelle Graham. TAIR10: K-box region and MADS-box transcription factor family protein | chr1:8593790-8595862 REVERSE LENGTH=250 SoyBaseE_val: 3.00E-53ISS
GO:0001708GO-bp Annotation by Michelle Graham. GO Biological Process: cell fate specification SoyBaseN/AISS
GO:0006355GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0009908GO-bp Annotation by Michelle Graham. GO Biological Process: flower development SoyBaseN/AISS
GO:0010093GO-bp Annotation by Michelle Graham. GO Biological Process: specification of floral organ identity SoyBaseN/AISS
GO:0048440GO-bp Annotation by Michelle Graham. GO Biological Process: carpel development SoyBaseN/AISS
GO:0048481GO-bp Annotation by Michelle Graham. GO Biological Process: ovule development SoyBaseN/AISS
GO:0048507GO-bp Annotation by Michelle Graham. GO Biological Process: meristem development SoyBaseN/AISS
GO:0048833GO-bp Annotation by Michelle Graham. GO Biological Process: specification of floral organ number SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003677GO-mf Annotation by Michelle Graham. GO Molecular Function: DNA binding SoyBaseN/AISS
GO:0003700GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
GO:0046983GO-mf Annotation by Michelle Graham. GO Molecular Function: protein dimerization activity SoyBaseN/AISS
KOG0014 KOG MADS box transcription factor JGI ISS
PTHR11945Panther MADS BOX PROTEIN JGI ISS
PTHR11945:SF19Panther MADS BOX PROTEIN JGI ISS
PF00319PFAM SRF-type transcription factor (DNA-binding and dimerisation domain) JGI ISS
PF01486PFAM K-box region JGI ISS
UniRef100_I1NGN5UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1NGN5_SOYBN SoyBaseE_val: 2.00E-164ISS
UniRef100_Q56NI6UniRef Annotation by Michelle Graham. Most informative UniRef hit: MADS box protein M3 n=1 Tax=Pisum sativum RepID=Q56NI6_PEA SoyBaseE_val: 8.00E-94ISS

Expression Patterns of Glyma20g29250
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma20g29250
ParalogEvidenceComments
Glyma10g38580 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma20g29250 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.20g153700 Wm82.a2.v1IGC As supplied by JGI

References for Glyma20g29250
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma20g29250
>Glyma20g29250.1   sequence type=CDS   gene model=Glyma20g29250   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGAAGAGGTAAGGTGGTTCTGGAGAGAATACAGAATAAGATCAATCGCCAAGTAACCTTCTCAAAGCGCAGAAATGGTTTGCTGAAGAAAGCCTTCGAGCTATCTGTGCTATGCGATGCTGAAATCGCTCTTATCATCTTCTCCAGCCGTGGCAAGCTTTTTCAATACAGTAGCACTGACATTAACAGAATCATTGATAAGTATCGTCAATGCTGCTTCAACATGTCTCAGACTGGCGACGTAACTGAACATCAATCGGAGCAGTGCTTATACCAGGAGCTTTTGATATTAAGAGTCAAGCATGAATCACTCCAGCGGACTCAAAGGAATCTTCTGGGAGAAGAACTAGAGCCACTTAGCATGAAAGAATTGCATAGTTTAGAGAAACAGCTGGATAGAACGCTTGGACAAGCTCGGAAGCACCTAACGCAGAAGCTGATATCACGAATTGACGAATTACATGGAAAGGTGCACAACCTGGAGCAGGTTAACAAGCATTTGGAATCTCAGGAAAGAGGTAAATGCACCCAGACTTGTGAAGGTTCTGCTAATAGTCATATTCGACTGCAAGATGCACAAGTCAATCAATTTGAATCTGAAACAACAGGTTCGTTTCGGCTTCAGCAAGAGCAGACTACTGCTTCAAAAGGAAAAGAAAGCAGTCACAATATAAATATATTGCGTCTTTGA
Predicted protein sequences of Glyma20g29250
>Glyma20g29250.1   sequence type=predicted peptide   gene model=Glyma20g29250   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGRGKVVLERIQNKINRQVTFSKRRNGLLKKAFELSVLCDAEIALIIFSSRGKLFQYSSTDINRIIDKYRQCCFNMSQTGDVTEHQSEQCLYQELLILRVKHESLQRTQRNLLGEELEPLSMKELHSLEKQLDRTLGQARKHLTQKLISRIDELHGKVHNLEQVNKHLESQERGKCTQTCEGSANSHIRLQDAQVNQFESETTGSFRLQQEQTTASKGKESSHNINILRL*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo