SoyBase Follow us on Twitter @SoyBaseDatabase
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma20g01610

Feature Type:gene_model
Chromosome:Gm20
Start:1123570
stop:1125484
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma20g01610
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G22640AT Annotation by Michelle Graham. TAIR10: myb domain protein 3 | chr1:8006289-8007219 FORWARD LENGTH=257 SoyBaseE_val: 2.00E-72ISS
GO:0006355GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0009611GO-bp Annotation by Michelle Graham. GO Biological Process: response to wounding SoyBaseN/AISS
GO:0009651GO-bp Annotation by Michelle Graham. GO Biological Process: response to salt stress SoyBaseN/AISS
GO:0009723GO-bp Annotation by Michelle Graham. GO Biological Process: response to ethylene stimulus SoyBaseN/AISS
GO:0009733GO-bp Annotation by Michelle Graham. GO Biological Process: response to auxin stimulus SoyBaseN/AISS
GO:0009737GO-bp Annotation by Michelle Graham. GO Biological Process: response to abscisic acid stimulus SoyBaseN/AISS
GO:0009739GO-bp Annotation by Michelle Graham. GO Biological Process: response to gibberellin stimulus SoyBaseN/AISS
GO:0009751GO-bp Annotation by Michelle Graham. GO Biological Process: response to salicylic acid stimulus SoyBaseN/AISS
GO:0009753GO-bp Annotation by Michelle Graham. GO Biological Process: response to jasmonic acid stimulus SoyBaseN/AISS
GO:0009800GO-bp Annotation by Michelle Graham. GO Biological Process: cinnamic acid biosynthetic process SoyBaseN/AISS
GO:0009892GO-bp Annotation by Michelle Graham. GO Biological Process: negative regulation of metabolic process SoyBaseN/AISS
GO:0046686GO-bp Annotation by Michelle Graham. GO Biological Process: response to cadmium ion SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003677GO-mf Annotation by Michelle Graham. GO Molecular Function: DNA binding SoyBaseN/AISS
GO:0003700GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity SoyBaseN/AISS
KOG0048 KOG Transcription factor, Myb superfamily JGI ISS
PTHR10641Panther MYB-RELATED JGI ISS
PF00249PFAM Myb-like DNA-binding domain JGI ISS
UniRef100_A8VPW4UniRef Annotation by Michelle Graham. Most informative UniRef hit: R2R3 MYB C2 repressor motif-like1 protein n=1 Tax=Vitis vinifera RepID=A8VPW4_VITVI SoyBaseE_val: 8.00E-88ISS
UniRef100_UPI000233D9C8UniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233D9C8 related cluster n=1 Tax=unknown RepID=UPI000233D9C8 SoyBaseE_val: 2.00E-163ISS

Expression Patterns of Glyma20g01610
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma20g01610
ParalogEvidenceComments
Glyma07g33960 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma20g01610 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.20g013000 Wm82.a2.v1IGC As supplied by JGI

References for Glyma20g01610
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma20g01610
>Glyma20g01610.2   sequence type=CDS   gene model=Glyma20g01610   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAGGAAGCCTAGTTGTGATATCAAAGAATTGAACAAAGGAGCTTGGTCCAAACAAGAAGACCAGAAACTCGTAGATTATATCAAGAAACATGGTGAAGTTTGTTGGCGTACACTCCCCCAGGCTGCAGGTTTACATCGGTGTGGTAAAAGTTGTAGGCTGAGATGGATAAACTATCTACGTCCAGACCTCAAAAGAGGCAACTTTGCTGAAGATGAAGAAGATCTCATCATCAAGCTTCATGCCCTGCTAGGCAACCGGTGGTCACTAATAGCTGGGAGATTGCCTGGACGTACAGATAATGAAGTGAAGAATTATTGGAATTCTCATATAAGAAAAAAGCTTATTAGCAATGGCATTGACCCAAATAATCATAGATTAAACCATACAATCCCTTCCGTTTATCAGAATCCACCTATGTCTGATGATAGTTCAAAACACTTTGGCATGAAAGACAATAATAGCAAGAACGAGACAAGCAAATCACCTCGTGTTTACAACCATGGTGAAGTCTCAGATGCTGCGAGTGGTGAGGCTGAGTCATCATGTGCATTGCCAGATTTAAACCTTGATCTCTCTATTTGCGAAAAAAATCTAAAACCATTTCACGAATCTAAGTTGTCGAGGAAAGTGCCATTTGATTCCCCTTCTACACTTCTTCTGTTTCAGTAA
Predicted protein sequences of Glyma20g01610
>Glyma20g01610.2   sequence type=predicted peptide   gene model=Glyma20g01610   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MRKPSCDIKELNKGAWSKQEDQKLVDYIKKHGEVCWRTLPQAAGLHRCGKSCRLRWINYLRPDLKRGNFAEDEEDLIIKLHALLGNRWSLIAGRLPGRTDNEVKNYWNSHIRKKLISNGIDPNNHRLNHTIPSVYQNPPMSDDSSKHFGMKDNNSKNETSKSPRVYNHGEVSDAASGEAESSCALPDLNLDLSICEKNLKPFHESKLSRKVPFDSPSTLLLFQ*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo