SoyBase Follow us on Twitter @SoyBaseDatabase
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma19g33421

Feature Type:gene_model
Chromosome:Gm19
Start:41048737
stop:41051057
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma19g33421
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G03430AT Annotation by Michelle Graham. TAIR10: histidine-containing phosphotransfer factor 5 | chr1:848159-849235 FORWARD LENGTH=157 SoyBaseE_val: 3.00E-46ISS
GO:0000160GO-bp Annotation by Michelle Graham. GO Biological Process: phosphorelay signal transduction system SoyBaseN/AISS
GO:0000165GO-bp Annotation by Michelle Graham. GO Biological Process: MAPK cascade SoyBaseN/AISS
GO:0006355GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0006612GO-bp Annotation by Michelle Graham. GO Biological Process: protein targeting to membrane SoyBaseN/AISS
GO:0009617GO-bp Annotation by Michelle Graham. GO Biological Process: response to bacterium SoyBaseN/AISS
GO:0009736GO-bp Annotation by Michelle Graham. GO Biological Process: cytokinin mediated signaling pathway SoyBaseN/AISS
GO:0009862GO-bp Annotation by Michelle Graham. GO Biological Process: systemic acquired resistance, salicylic acid mediated signaling pathway SoyBaseN/AISS
GO:0009863GO-bp Annotation by Michelle Graham. GO Biological Process: salicylic acid mediated signaling pathway SoyBaseN/AISS
GO:0009867GO-bp Annotation by Michelle Graham. GO Biological Process: jasmonic acid mediated signaling pathway SoyBaseN/AISS
GO:0010029GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of seed germination SoyBaseN/AISS
GO:0010310GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of hydrogen peroxide metabolic process SoyBaseN/AISS
GO:0010363GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of plant-type hypersensitive response SoyBaseN/AISS
GO:0031348GO-bp Annotation by Michelle Graham. GO Biological Process: negative regulation of defense response SoyBaseN/AISS
GO:0031537GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of anthocyanin metabolic process SoyBaseN/AISS
GO:0035304GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of protein dephosphorylation SoyBaseN/AISS
GO:0043069GO-bp Annotation by Michelle Graham. GO Biological Process: negative regulation of programmed cell death SoyBaseN/AISS
GO:0048831GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of shoot development SoyBaseN/AISS
GO:0051707GO-bp Annotation by Michelle Graham. GO Biological Process: response to other organism SoyBaseN/AISS
GO:0080036GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of cytokinin mediated signaling pathway SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0004871GO-mf Annotation by Michelle Graham. GO Molecular Function: signal transducer activity SoyBaseN/AISS
GO:0009927GO-mf Annotation by Michelle Graham. GO Molecular Function: histidine phosphotransfer kinase activity SoyBaseN/AISS
GO:0043424GO-mf Annotation by Michelle Graham. GO Molecular Function: protein histidine kinase binding SoyBaseN/AISS
KOG4747 KOG Two-component phosphorelay intermediate involved in MAP kinase cascade regulation JGI ISS
PF01627PFAM Hpt domain JGI ISS
UniRef100_G7I2T8UniRef Annotation by Michelle Graham. Most informative UniRef hit: Histidine phosphotransfer protein n=1 Tax=Medicago truncatula RepID=G7I2T8_MEDTR SoyBaseE_val: 4.00E-63ISS
UniRef100_UPI000233EFE9UniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233EFE9 related cluster n=1 Tax=unknown RepID=UPI000233EFE9 SoyBaseE_val: 6.00E-90ISS

Expression Patterns of Glyma19g33421
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma19g33421 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.19g151900 Wm82.a2.v1IGC As supplied by JGI

References for Glyma19g33421
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma19g33421
>Glyma19g33421.1   sequence type=CDS   gene model=Glyma19g33421   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
GGATTTCTGGATGATCAGTTCAATCAGCTTCAGAAACTGCAAGATGAGAGTAGTCCATATTTTGTGATGGAGGTTATGACCATGTTCTTTGGTGATTCTGAGAAACTTCTAAATAGAATTGCACTAGCTCTAGAACAAAAACCTGTGGATTTCAAAAGTGTAGATTCTAATGTCCATCAGTTCAAAGGAAGCAGTGCCAGTGTTGGTGTTGCGAGAGTTAAAGATGTCTGCACTAACTTCAGAAATATTTGCGAGGCTCAGAACCTGGAAGGGTGTGTGAATTGTCTGCAACAGTTGCAGCAAGAATACTCTCTATTGAGGATCAATCTTCAATACTTATTTAGACTGCAACAAGAAATCCAAGCTGCTGGTGGTTCAGTTTCCACAGTGGAATAG
Predicted protein sequences of Glyma19g33421
>Glyma19g33421.1   sequence type=predicted peptide   gene model=Glyma19g33421   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
GFLDDQFNQLQKLQDESSPYFVMEVMTMFFGDSEKLLNRIALALEQKPVDFKSVDSNVHQFKGSSASVGVARVKDVCTNFRNICEAQNLEGCVNCLQQLQQEYSLLRINLQYLFRLQQEIQAAGGSVSTVE*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo