Glyma19g06080 - SoyBase

SoyBase Follow us on Twitter @SoyBaseDatabase
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma19g06080

Feature Type:	gene_model
Chromosome:	Gm19
Start:	6783734
stop:	6786506
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma19g06080

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT2G29540	AT	Annotation by Michelle Graham. TAIR10: RNApolymerase 14 kDa subunit \| chr2:12642727-12643828 FORWARD LENGTH=122	SoyBase	E_val: 2.00E-41	ISS
GO:0006351	GO-bp	Annotation by Michelle Graham. GO Biological Process: transcription, DNA-dependent	SoyBase	N/A	ISS
GO:0009304	GO-bp	Annotation by Michelle Graham. GO Biological Process: tRNA transcription	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0005666	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: DNA-directed RNA polymerase III complex	SoyBase	N/A	ISS
GO:0003677	GO-mf	Annotation by Michelle Graham. GO Molecular Function: DNA binding	SoyBase	N/A	ISS
GO:0003899	GO-mf	Annotation by Michelle Graham. GO Molecular Function: DNA-directed RNA polymerase activity	SoyBase	N/A	ISS
GO:0046983	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein dimerization activity	SoyBase	N/A	ISS
KOG3438	KOG	DNA-directed RNA polymerase, subunit L	JGI		ISS
PTHR13946	Panther	DNA-DIRECTED RNA POLYMERASE I,II,III	JGI		ISS
PTHR13946:SF17	Panther	DNA-DIRECTED RNA POLYMERASES I AND III	JGI		ISS
UniRef100_G7KSV3	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: DNA-directed RNA polymerases I and III subunit RPAC2 n=1 Tax=Medicago truncatula RepID=G7KSV3_MEDTR	SoyBase	E_val: 3.00E-56	ISS
UniRef100_I1N6N9	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1N6N9_SOYBN	SoyBase	E_val: 4.00E-73	ISS

Expression Patterns of Glyma19g06080

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma19g06080 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.19g045500	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma19g06080

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma19g06080

Limit To All Plant Sequences

>Glyma19g06080.1   sequence type=CDS   gene model=Glyma19g06080   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAGCTTGGGTCATATTCTGATCAGAGTAAATCAACCTTTTCTCTGGTGGATGAGGATCACACATTTGCAAACTCTGTCCGGTTCACTCTAAATCAAGATCCAAGAGTGACATTTTGTGGGTACAGCATTCCTCATCCTTCAGATAATCGAGTTAATATCAGAGTGCAGACAACAGGGGATCCAGCAAGAGAAGTGTTGAAAGATGGATGCCAGGATCTGATGCTAATGTGCCAGCATGTTAGGAGCACTTTTGATAATGCTATGACTGATTTTAAAAGGACCCAAACTAATACTGAACAGGAAATGGATACCAAATAA

Predicted protein sequences of Glyma19g06080

Limit To All Plant Sequences

>Glyma19g06080.1   sequence type=predicted peptide   gene model=Glyma19g06080   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MELGSYSDQSKSTFSLVDEDHTFANSVRFTLNQDPRVTFCGYSIPHPSDNRVNIRVQTTGDPAREVLKDGCQDLMLMCQHVRSTFDNAMTDFKRTQTNTEQEMDTK*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain