Glyma19g01580 - SoyBase

SoyBase Follow us on Twitter @SoyBaseDatabase
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma19g01580

Feature Type:	gene_model
Chromosome:	Gm19
Start:	1191783
stop:	1195546
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma19g01580

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G14910	AT	Annotation by Michelle Graham. TAIR10: Heavy metal transport/detoxification superfamily protein \| chr5:4823815-4825196 FORWARD LENGTH=178	SoyBase	E_val: 7.00E-42	ISS
GO:0006098	GO-bp	Annotation by Michelle Graham. GO Biological Process: pentose-phosphate shunt	SoyBase	N/A	ISS
GO:0019288	GO-bp	Annotation by Michelle Graham. GO Biological Process: isopentenyl diphosphate biosynthetic process, mevalonate-independent pathway	SoyBase	N/A	ISS
GO:0030001	GO-bp	Annotation by Michelle Graham. GO Biological Process: metal ion transport	SoyBase	N/A	ISS
GO:0045036	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein targeting to chloroplast	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0009535	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid membrane	SoyBase	N/A	ISS
GO:0009570	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast stroma	SoyBase	N/A	ISS
GO:0009579	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: thylakoid	SoyBase	N/A	ISS
GO:0009941	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast envelope	SoyBase	N/A	ISS
GO:0046872	GO-mf	Annotation by Michelle Graham. GO Molecular Function: metal ion binding	SoyBase	N/A	ISS
UniRef100_B9RUE7	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Metal ion binding protein, putative n=1 Tax=Ricinus communis RepID=B9RUE7_RICCO	SoyBase	E_val: 2.00E-42	ISS
UniRef100_I1N5W8	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1N5W8_SOYBN	SoyBase	E_val: 6.00E-123	ISS

Expression Patterns of Glyma19g01580

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma19g01580

Paralog	Evidence	Comments
Glyma13g04500	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma19g01580 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.19g012900	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma19g01580

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma19g01580

Limit To All Plant Sequences

>Glyma19g01580.2   sequence type=CDS   gene model=Glyma19g01580   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGAAATTACGAATTTGTTTGTGAGAGTATACAACGATGTTCTTTTCCTGTATGGATAGAAAGATTAGATAGCGTGTGGGAAATCAAGAGCAGAGCTGAAACTTCTTCTCTTCACTTGAAACTGTGTTTGAAAAAGAAAAAAAACATGGCCACACTATTCTCACCTTTGTCTCTGCACTCTGCTCGCCCCTCTTCTTCTTCCTTTTCTTCTTCTTCTTCTTCTTCTTCATCTTCTCCCTTCTTTGCCTTTTGCAGCTTCCCTTTGCGCTCTCGCATTTCATCTTTGAAGGCACAAACAATTCTTCTTCAGAAGATGAAGCGCGTGGTAAAGGCAGTGGAAGAAGAGACCCAGCAAGAACTCACCGCTGTGGATGAGTCTGAACAACCATCAACCTCCGAAGCACCACCCGTTGTGGTTCCCGTTTCCCCATCAGATACTCTCACCATGTTCTTTCAGGCAGAGGGAACAGTGAGTGAAACAGCTATTCCAGCTTTAACCAAAGCTTTAGAGGAGACAGATGGTGTTACTGATTTGAAGTTTCAGCTTGCCGAGGGACTTGCAATTTTAGAGTTGAAGAAGCAGACAACAGTCCAAGCTACAGGAGTGGCTTCTGGTCTTTTAGAAACCATACAAGGTTCAGGCTTTAAACTACAGACATTAAATCTGAGTTTTGAGGATGAAGAAGTTGCAGTTGCCTAG

Predicted protein sequences of Glyma19g01580

Limit To All Plant Sequences

>Glyma19g01580.2   sequence type=predicted peptide   gene model=Glyma19g01580   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGNYEFVCESIQRCSFPVWIERLDSVWEIKSRAETSSLHLKLCLKKKKNMATLFSPLSLHSARPSSSSFSSSSSSSSSSPFFAFCSFPLRSRISSLKAQTILLQKMKRVVKAVEEETQQELTAVDESEQPSTSEAPPVVVPVSPSDTLTMFFQAEGTVSETAIPALTKALEETDGVTDLKFQLAEGLAILELKKQTTVQATGVASGLLETIQGSGFKLQTLNLSFEDEEVAVA*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain