SoyBase Follow us on Twitter @SoyBaseDatabase
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma18g01340

Feature Type:gene_model
Chromosome:Gm18
Start:701671
stop:703255
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G48140AT Annotation by Michelle Graham. TAIR10: B12D protein | chr3:17778471-17779299 FORWARD LENGTH=88 SoyBaseE_val: 5.00E-43ISS
GO:0010150GO-bp Annotation by Michelle Graham. GO Biological Process: leaf senescence SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0005777GO-cc Annotation by Michelle Graham. GO Cellular Compartment: peroxisome SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
PF06522PFAM B12D protein JGI ISS
UniRef100_G7J2H3UniRef Annotation by Michelle Graham. Most informative UniRef hit: B12D protein n=1 Tax=Medicago truncatula RepID=G7J2H3_MEDTR SoyBaseE_val: 3.00E-45ISS
UniRef100_I1MYJ0UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MYJ0_SOYBN SoyBaseE_val: 2.00E-59ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma11g37370 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.18g009800 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma18g01340.2   sequence type=CDS   gene model=Glyma18g01340   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCCGCCAACAGATGGTTAAAACCTGAGGTATACCCACTGTTCGCTGCAGTTGGTGTGGCTGTTGGGATCTGCGGTATGCAACTTGTCAGGAATATAACCACCAATCCTGAAGTCAGGGTGACCAAACAGAACAGAGCTGCAGGAATTCTTGAGAATTTTGCAGAGGGAGAGAAATATTCACAACATAGCCTGAGGAAGTATGTCCGCGGCAAACAACCTCAGATTATGCCATCCGTCAACAACTTCTTCTCTGATCCATCAAACTAA

>Glyma18g01340.2   sequence type=predicted peptide   gene model=Glyma18g01340   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAANRWLKPEVYPLFAAVGVAVGICGMQLVRNITTNPEVRVTKQNRAAGILENFAEGEKYSQHSLRKYVRGKQPQIMPSVNNFFSDPSN*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo