Glyma17g32061 - SoyBase

SoyBase Follow us on Twitter @SoyBaseDatabase
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma17g32061

Feature Type:	gene_model
Chromosome:	Gm17
Start:	35289048
stop:	35289269
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma17g32061

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G20395	AT	Annotation by Michelle Graham. TAIR10: RING/U-box superfamily protein \| chr3:7112020-7113792 REVERSE LENGTH=223	SoyBase	E_val: 5.00E-12	ISS
PTHR22765	Panther	RING FINGER AND PROTEASE ASSOCIATED DOMAIN-CONTAINING	JGI		ISS
PF00097	PFAM	Zinc finger, C3HC4 type (RING finger)	JGI		ISS
UniRef100_I1MWT2	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=1 Tax=Glycine max RepID=I1MWT2_SOYBN	SoyBase	E_val: 3.00E-46	ISS
UniRef100_J9HTH2	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: RING-finger-containing ubiquitin ligase n=1 Tax=Oxytricha trifallax RepID=J9HTH2_9SPIT	SoyBase	E_val: 5.00E-10	ISS

Expression Patterns of Glyma17g32061

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma17g32061 not represented in the dataset	Glyma17g32061 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma17g32061 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.17g211800	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma17g32061

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma17g32061

Limit To All Plant Sequences

>Glyma17g32061.1   sequence type=CDS   gene model=Glyma17g32061   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAGAGCCTTACCCCCTGTTACATGCTTTTGTGATGATGGAACCACTGGATCCAAACATGATTGTCCTATTTGCATAGAAGAATTTAAGAACGGGGAGCTAATTCAACCTTTTGGAGTGTGTGTTCATGAATTTCATTCATCTTGCATCAACTCATGGTTACTCAGGGGAAAAACTACTTGCCCAGTTTGTCGCAAGGAATTGTCATTTACTATGTTCTAA

Predicted protein sequences of Glyma17g32061

Limit To All Plant Sequences

>Glyma17g32061.1   sequence type=predicted peptide   gene model=Glyma17g32061   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MRALPPVTCFCDDGTTGSKHDCPICIEEFKNGELIQPFGVCVHEFHSSCINSWLLRGKTTCPVCRKELSFTMF*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain