Glyma16g33710 - SoyBase

SoyBase Follow us on Twitter @SoyBaseDatabase
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma16g33710

Feature Type:	gene_model
Chromosome:	Gm16
Start:	36543872
stop:	36544989
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma16g33710

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G73260	AT	Annotation by Michelle Graham. TAIR10: kunitz trypsin inhibitor 1 \| chr1:27547410-27548057 REVERSE LENGTH=215	SoyBase	E_val: 5.00E-13	ISS
GO:0009651	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to salt stress	SoyBase	N/A	ISS
GO:0009751	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to salicylic acid stimulus	SoyBase	N/A	ISS
GO:0010167	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to nitrate	SoyBase	N/A	ISS
GO:0012501	GO-bp	Annotation by Michelle Graham. GO Biological Process: programmed cell death	SoyBase	N/A	ISS
GO:0015706	GO-bp	Annotation by Michelle Graham. GO Biological Process: nitrate transport	SoyBase	N/A	ISS
GO:0042542	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to hydrogen peroxide	SoyBase	N/A	ISS
GO:0042742	GO-bp	Annotation by Michelle Graham. GO Biological Process: defense response to bacterium	SoyBase	N/A	ISS
GO:0005576	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: extracellular region	SoyBase	N/A	ISS
GO:0005739	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion	SoyBase	N/A	ISS
GO:0004866	GO-mf	Annotation by Michelle Graham. GO Molecular Function: endopeptidase inhibitor activity	SoyBase	N/A	ISS
PF00197	PFAM	Trypsin and protease inhibitor	JGI		ISS
UniRef100_B1ACD3	UniRef	Annotation by Michelle Graham. Best UniRef hit: Putative Kunitz trypsin protease inhibitor n=1 Tax=Glycine max RepID=B1ACD3_SOYBN	SoyBase	E_val: 1.00E-154	ISS
UniRef100_Q8RVX2	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Protease inhibitor n=1 Tax=Sesbania rostrata RepID=Q8RVX2_SESRO	SoyBase	E_val: 3.00E-110	ISS

Expression Patterns of Glyma16g33710

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma16g33710 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.16g211700	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma16g33710

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma16g33710

Limit To All Plant Sequences

>Glyma16g33710.1   sequence type=CDS   gene model=Glyma16g33710   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAAGGTTTCCATTGCCAAGTTCCACTCCCTTCCCCTATGTTTTTTCCTTCTCTTGGCCTTCAACACAAAACCCCTCCTAGCAGCAGAACCAGAGCCAGTGGTTGATAAGCAAGGGAACCCTTTGGAGCCAGGAGTAGGGTACTACGTGTGGCCACTTTGGGCTGATGAAGGAGGCCTCACACTAGGCCAAACAAGGAACAAGACATGCCCTCTTTATGTTATCCGTGACCCTTCATTCATTGGCACCCCAGTTTCATTCTTAGCACCAGGCCTTGACCATGTTCCAACACTCACTGATCTAACCATTGATTTCCCTGTGGTGACAGTGTGTAACCAGCCAACAGTGTGGAGGCTCAACAAGGTAGGGTCAGGGTTCTGGTTTGTGAGCACCAGTGGTGACCCTAATGATATCACTAGCAAGTTCAAGATTGAGAGGCTTGAAGGGGATCATGCTTATGAGATCTACAGCTTCAAGTTCTGCCCCAGTGTGCCTGGTGCGCTGTGTGCTCCTGTGGGGACTTTTGAAGATGCTGATGGAACCAAAGTCATGGCTGTGGGGGATGATATTGAGCCTTACTATGTGAGGTTTCAAAAAGTCTCCATCTTTGGTCAAGACAAGAAACAACCTTTTAGCATTTTGTAG

Predicted protein sequences of Glyma16g33710

Limit To All Plant Sequences

>Glyma16g33710.1   sequence type=predicted peptide   gene model=Glyma16g33710   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MKVSIAKFHSLPLCFFLLLAFNTKPLLAAEPEPVVDKQGNPLEPGVGYYVWPLWADEGGLTLGQTRNKTCPLYVIRDPSFIGTPVSFLAPGLDHVPTLTDLTIDFPVVTVCNQPTVWRLNKVGSGFWFVSTSGDPNDITSKFKIERLEGDHAYEIYSFKFCPSVPGALCAPVGTFEDADGTKVMAVGDDIEPYYVRFQKVSIFGQDKKQPFSIL*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain