SoyBase Follow us on Twitter @SoyBaseDatabase
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma16g28605

Feature Type:gene_model
Chromosome:Gm16
Start:32516966
stop:32518687
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G21310AT Annotation by Michelle Graham. TAIR10: extensin 3 | chr1:7453693-7454988 REVERSE LENGTH=431 SoyBaseE_val: 3.00E-14ISS
GO:0009664GO-bp Annotation by Michelle Graham. GO Biological Process: plant-type cell wall organization SoyBaseN/AISS
GO:0009735GO-bp Annotation by Michelle Graham. GO Biological Process: response to cytokinin stimulus SoyBaseN/AISS
GO:0043161GO-bp Annotation by Michelle Graham. GO Biological Process: proteasomal ubiquitin-dependent protein catabolic process SoyBaseN/AISS
GO:0043248GO-bp Annotation by Michelle Graham. GO Biological Process: proteasome assembly SoyBaseN/AISS
GO:0048767GO-bp Annotation by Michelle Graham. GO Biological Process: root hair elongation SoyBaseN/AISS
GO:0051788GO-bp Annotation by Michelle Graham. GO Biological Process: response to misfolded protein SoyBaseN/AISS
GO:0005199GO-mf Annotation by Michelle Graham. GO Molecular Function: structural constituent of cell wall SoyBaseN/AISS
PF04554PFAM Extensin-like region JGI ISS
UniRef100_D8QY50UniRef Annotation by Michelle Graham. Best UniRef hit: Putative uncharacterized protein n=1 Tax=Selaginella moellendorffii RepID=D8QY50_SELML SoyBaseE_val: 2.00E-37ISS
UniRef100_Q8LK15UniRef Annotation by Michelle Graham. Most informative UniRef hit: Extensin n=1 Tax=Brassica napus RepID=Q8LK15_BRANA SoyBaseE_val: 3.00E-21ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma16g28605 not represented in the dataset

Glyma16g28605 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.16g170100 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma16g28605.1   sequence type=CDS   gene model=Glyma16g28605   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGGTCTCTAATGGCCTCTCTTACTCTCACTCTTGTATTGGCAATAGTTTCTCTAAGCTTGTCATCTCAAGCCTCAGCTGACAAGTACGACTATTCATCTCCACCACCACCAGTTTACAAGTACAAGTCCCCACCACCACCCTACAAGTATTCATCTCCTCCACCACCTCCTAAGAAGCCTTACAAATACCCATCACCACCACCACCAGTTTACAAATACAAGTCACCACCACCACCCTACAAGTACCCTTCTCCTCCACCACCACCTAAAAAGCCCTACAAATACCCATCACCCCCACCTCCAGTTTACAAATACAAGTCACCACCACCACCAGTTTACAAGTACAAGTCCCCACCACCACCACCTAAGAAGCCCTACAAATACCCATCACCACCACCACCAGTTTACAAATACAAGTCACCACCCCCACCCTACAAGTACCCTTCTCCTCCACCACCTCCTAAGAAACCCTACAAATACCCATCTCCTCCACCCCCAGTATACAAGTACAAGTCCCCTCCTCCTCCATACAAGTACTCTTCTCCTCCACCTCCACCATACAAGTACCCTTCTCCACCACCCCCAGCTTACTACTACAAGTCACCTCCACCACCACCTAAGAAACCATACAAGTATCCATCTCCACCTCCTCCACACTATGTCTATGCATCACCACCTCCCCCATACCACTACTAG

>Glyma16g28605.1   sequence type=predicted peptide   gene model=Glyma16g28605   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGSLMASLTLTLVLAIVSLSLSSQASADKYDYSSPPPPVYKYKSPPPPYKYSSPPPPPKKPYKYPSPPPPVYKYKSPPPPYKYPSPPPPPKKPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYKSPPPPYKYPSPPPPPKKPYKYPSPPPPVYKYKSPPPPYKYSSPPPPPYKYPSPPPPAYYYKSPPPPPKKPYKYPSPPPPHYVYASPPPPYHY*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo