SoyBase Follow us on Twitter @SoyBaseDatabase
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma15g20631

Feature Type:gene_model
Chromosome:Gm15
Start:18565757
stop:18566654
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma15g20631
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G32583AT Annotation by Michelle Graham. TAIR10: FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: endomembrane system; BEST Arabidopsis thaliana protein match is: tapetum determinant 1 (TAIR:AT4G24972.1); Has 35333 Blast hits to 34131 proteins in 2444 species: Archae - 798; Bacteria - 22429; Metazoa - 974; Fungi - 991; Plants - 531; Viruses - 0; Other Eukaryotes - 9610 (source: NCBI BLink). | chr1:11787351-11788103 FORWARD LENGTH=179 SoyBaseE_val: 7.00E-28ISS
GO:0009408GO-bp Annotation by Michelle Graham. GO Biological Process: response to heat SoyBaseN/AISS
GO:0005576GO-cc Annotation by Michelle Graham. GO Cellular Compartment: extracellular region SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
UniRef100_G7JNW5UniRef Annotation by Michelle Graham. Most informative UniRef hit: DNA-directed RNA polymerase n=1 Tax=Medicago truncatula RepID=G7JNW5_MEDTR SoyBaseE_val: 4.00E-71ISS
UniRef100_I1MGE9UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MGE9_SOYBN SoyBaseE_val: 2.00E-116ISS

Expression Patterns of Glyma15g20631
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma15g20631 not represented in the dataset
Glyma15g20631 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma15g20631 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.15g184800 Wm82.a2.v1IGC As supplied by JGI

References for Glyma15g20631
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma15g20631
>Glyma15g20631.1   sequence type=CDS   gene model=Glyma15g20631   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAACATGACCATCACAAACTCTTGTCCTCTGATAATCTTCCTATGCTTCATGATGCCCCTTTTTGTATTTTGTGACGAGGGAACGCATTCAGGACCATCGACCCAGATTTTGCATTCTTCTCATGAAGACAAAAACAGGTCCATAACAGTGTCAATGAAAGTAGAACATGCACATTCTGCCTCTAGAAAATTTTGGTTGCATGGTACTTGCACAAGCAAAGACATAAGCATCTCACAAAGCCAAACTTCTACACCAGGAATCCCACAGTTCATAGTGCAAATTGTTAACAATTGTGTTTCTGGATGTGCTCCTAGTGACATCCACTTCCACTGTGGCATGTTTGCTTCTGCAAGAATGGTGAACCCAAGATTGTTCAAGAGGATCTCCTGTGATGATTGCTTAGTGAATGGAGGGAACCCTTTAGCCCCTAGCCAGATCATCAGATTCACATATTCCAATACCTTCTCCTACCCTCTTGCTTTTAAGTCTGCCAAATTTTGCTGA
Predicted protein sequences of Glyma15g20631
>Glyma15g20631.1   sequence type=predicted peptide   gene model=Glyma15g20631   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MNMTITNSCPLIIFLCFMMPLFVFCDEGTHSGPSTQILHSSHEDKNRSITVSMKVEHAHSASRKFWLHGTCTSKDISISQSQTSTPGIPQFIVQIVNNCVSGCAPSDIHFHCGMFASARMVNPRLFKRISCDDCLVNGGNPLAPSQIIRFTYSNTFSYPLAFKSAKFC*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo