Glyma15g12380 - SoyBase

SoyBase Follow us on Twitter @SoyBaseDatabase
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma15g12380

Feature Type:	gene_model
Chromosome:	Gm15
Start:	9150175
stop:	9152755
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma15g12380

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G27330	AT	Annotation by Michelle Graham. TAIR10: Ribosome associated membrane protein RAMP4 \| chr1:9493064-9493898 FORWARD LENGTH=68	SoyBase	E_val: 8.00E-28	ISS
GO:0006979	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to oxidative stress	SoyBase	N/A	ISS
GO:0005739	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion	SoyBase	N/A	ISS
GO:0003674	GO-mf	Annotation by Michelle Graham. GO Molecular Function: molecular function	SoyBase	N/A	ISS
KOG3491	KOG	Predicted membrane protein	JGI		ISS
PTHR15601	Panther	STRESS ASSOCIATED ENDOPLASMIC RETICULUM PROTEIN (SERP1/RAMP4)	JGI		ISS
PF06624	PFAM	Ribosome associated membrane protein RAMP4	JGI		ISS
UniRef100_B9RMD3	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Stress associated endoplasmic reticulum protein, putative n=1 Tax=Ricinus communis RepID=B9RMD3_RICCO	SoyBase	E_val: 8.00E-26	ISS
UniRef100_I1MFQ3	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MFQ3_SOYBN	SoyBase	E_val: 4.00E-38	ISS

Expression Patterns of Glyma15g12380

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma15g12380

Paralog	Evidence	Comments
Glyma09g01480	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma15g12380 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.15g116900	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma15g12380

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma15g12380

Limit To All Plant Sequences

>Glyma15g12380.1   sequence type=CDS   gene model=Glyma15g12380   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGACTACTTCAAAGCGCCTAGCGGACAGGAAAATTGCAAGGTTTGAAAAGAATATTAGCAAGAAAAGTTCAGAAAACTCTAAGAAGGGATATGCCTATCCTGTGGGCCCCATCGTGCTTGGATTCTTCGTCTTTGTTGTCGTTGGATCATCTCTGTTTCAGATTATTAGGACAGCTACTAGTCGTGGGATGGCCTAA

Predicted protein sequences of Glyma15g12380

Limit To All Plant Sequences

>Glyma15g12380.1   sequence type=predicted peptide   gene model=Glyma15g12380   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MTTSKRLADRKIARFEKNISKKSSENSKKGYAYPVGPIVLGFFVFVVVGSSLFQIIRTATSRGMA*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain