SoyBase Follow us on Twitter @SoyBaseDatabase
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma13g22631

Feature Type:gene_model
Chromosome:Gm13
Start:26122581
stop:26125822
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G02530AT Annotation by Michelle Graham. TAIR10: chloroplast thylakoid lumen protein | chr4:1112335-1114005 REVERSE LENGTH=216 SoyBaseE_val: 5.00E-38ISS
GO:0006098GO-bp Annotation by Michelle Graham. GO Biological Process: pentose-phosphate shunt SoyBaseN/AISS
GO:0006364GO-bp Annotation by Michelle Graham. GO Biological Process: rRNA processing SoyBaseN/AISS
GO:0006636GO-bp Annotation by Michelle Graham. GO Biological Process: unsaturated fatty acid biosynthetic process SoyBaseN/AISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0009409GO-bp Annotation by Michelle Graham. GO Biological Process: response to cold SoyBaseN/AISS
GO:0009697GO-bp Annotation by Michelle Graham. GO Biological Process: salicylic acid biosynthetic process SoyBaseN/AISS
GO:0009814GO-bp Annotation by Michelle Graham. GO Biological Process: defense response, incompatible interaction SoyBaseN/AISS
GO:0010027GO-bp Annotation by Michelle Graham. GO Biological Process: thylakoid membrane organization SoyBaseN/AISS
GO:0015979GO-bp Annotation by Michelle Graham. GO Biological Process: photosynthesis SoyBaseN/AISS
GO:0015995GO-bp Annotation by Michelle Graham. GO Biological Process: chlorophyll biosynthetic process SoyBaseN/AISS
GO:0016117GO-bp Annotation by Michelle Graham. GO Biological Process: carotenoid biosynthetic process SoyBaseN/AISS
GO:0019288GO-bp Annotation by Michelle Graham. GO Biological Process: isopentenyl diphosphate biosynthetic process, mevalonate-independent pathway SoyBaseN/AISS
GO:0019684GO-bp Annotation by Michelle Graham. GO Biological Process: photosynthesis, light reaction SoyBaseN/AISS
GO:0042742GO-bp Annotation by Michelle Graham. GO Biological Process: defense response to bacterium SoyBaseN/AISS
GO:0043085GO-bp Annotation by Michelle Graham. GO Biological Process: positive regulation of catalytic activity SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0009534GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid SoyBaseN/AISS
GO:0009535GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid membrane SoyBaseN/AISS
GO:0009543GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid lumen SoyBaseN/AISS
GO:0009570GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast stroma SoyBaseN/AISS
GO:0009579GO-cc Annotation by Michelle Graham. GO Cellular Compartment: thylakoid SoyBaseN/AISS
GO:0009941GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast envelope SoyBaseN/AISS
GO:0031977GO-cc Annotation by Michelle Graham. GO Cellular Compartment: thylakoid lumen SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
UniRef100_G7JE46UniRef Annotation by Michelle Graham. Most informative UniRef hit: Thylakoid lumenal 16.5 kDa protein n=1 Tax=Medicago truncatula RepID=G7JE46_MEDTR SoyBaseE_val: 5.00E-51ISS
UniRef100_UPI000233D1D8UniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233D1D8 related cluster n=1 Tax=unknown RepID=UPI000233D1D8 SoyBaseE_val: 2.00E-87ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma13g22631 not represented in the dataset

Glyma13g22631 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma17g12190 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.13g157900 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma13g22631.1   sequence type=CDS   gene model=Glyma13g22631   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGACCAACAGCAACGCAAACATATGTTTACCACACCATCAAGTTCAGTGTGAAAGGCAATTAACTCTTTGCCAAGCAGTTAATCGGCTAGCAACACACACTCCAATTTTGACCAAAAGAGGCTTATCCATCAGTTTTCTCACCGCATTTTTGGTTTCATTGGCTGGTGAGGATGCTAATGCTGCAATACTTGAAGCAGATGATGACGAGGAGCGGTTGGAAAAAGTAAAGAGGGATAGAAAAAAGAGACTTGAGAGACAAGGTGTGATCAAATCATCCACCAAAGAAACAGGGTATCTTCAGGATTTGGTGTATAAACTAAGTAAAGTTGGTAAAGCAATTGAAAACAGTGATCTATCTACAGCTGCTTCTGTGTTTGGGAGTGGCACTGATACTGATTGGGTGCAAAATGCTAATATATCTTTGAATAAGTTTCTGGGTAACCTTTTAACATTTGAGTGCCAGTGCTGA

>Glyma13g22631.1   sequence type=predicted peptide   gene model=Glyma13g22631   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MTNSNANICLPHHQVQCERQLTLCQAVNRLATHTPILTKRGLSISFLTAFLVSLAGEDANAAILEADDDEERLEKVKRDRKKRLERQGVIKSSTKETGYLQDLVYKLSKVGKAIENSDLSTAASVFGSGTDTDWVQNANISLNKFLGNLLTFECQC*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo