SoyBase Follow us on Twitter @SoyBaseDatabase
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma11g01640

Feature Type:gene_model
Chromosome:Gm11
Start:982245
stop:983782
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G71450AT Annotation by Michelle Graham. TAIR10: Integrase-type DNA-binding superfamily protein | chr1:26927088-26927639 FORWARD LENGTH=183 SoyBaseE_val: 2.00E-64ISS
GO:0006355GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003677GO-mf Annotation by Michelle Graham. GO Molecular Function: DNA binding SoyBaseN/AISS
GO:0003700GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity SoyBaseN/AISS
PF00847PFAM AP2 domain JGI ISS
UniRef100_G7K7X9UniRef Annotation by Michelle Graham. Most informative UniRef hit: Ethylene-responsive transcription factor n=1 Tax=Medicago truncatula RepID=G7K7X9_MEDTR SoyBaseE_val: 8.00E-85ISS
UniRef100_I1LG45UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=2 Tax=Glycine max RepID=I1LG45_SOYBN SoyBaseE_val: 9.00E-122ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma01g44140 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.11g014200 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma11g01640.1   sequence type=CDS   gene model=Glyma11g01640   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGACATGCCTTCTTCAAGTTCAAGCCATGTTGTTGGCGCTGCTTCTTCTGCATACCGTGGCGTCCGTAAGAGGAAATGGGGGAAGTGGGTGTCCGAAATCCGCGAGCCAGGAACCAAGACAAGAATCTGGCTCGGGAGTTTCGAGACTCCCGAGATGGCCGCCGCAGCGTACGACGTCGCCGCCTTGCATTTCAGGGGCCGCGACGCCAGGCTCAACTTCCCTGAGCTTGCCAGCACCCTGCCGCGCCCCGTCAGCAACAATGCCGACCACATACGCATGGCGGCCCACGAGGCCGCTCTCAGGCTCCGGACAAACCCCGCCGCGCCCAACACCGTTGGCTCCGCCGGCTCCGTCTCCGCCGCGCCGCTAACCGTGAGGCTCTCCCCCACTCAGATTCAGGCCATCAATGACTCGCCCATGGACTCACCACAGACTTGGATGCAAATGCCAGACACTTTCATGATGCATGATCAGTCCATGATGTTCGCAAACGGGTATTCCTTTGAGGACAACGAGTGGGAGGATATGCACAATGATTCTCTCTGGGATCCTTAG

>Glyma11g01640.1   sequence type=predicted peptide   gene model=Glyma11g01640   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MDMPSSSSSHVVGAASSAYRGVRKRKWGKWVSEIREPGTKTRIWLGSFETPEMAAAAYDVAALHFRGRDARLNFPELASTLPRPVSNNADHIRMAAHEAALRLRTNPAAPNTVGSAGSVSAAPLTVRLSPTQIQAINDSPMDSPQTWMQMPDTFMMHDQSMMFANGYSFEDNEWEDMHNDSLWDP*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo