Glyma09g01380 - SoyBase

SoyBase Follow us on Twitter @SoyBaseDatabase
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma09g01380

Feature Type:	gene_model
Chromosome:	Gm09
Start:	846093
stop:	851432
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma09g01380

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G02870	AT	Annotation by Michelle Graham. TAIR10: Inositol monophosphatase family protein \| chr3:627742-629682 REVERSE LENGTH=271	SoyBase	E_val: 8.00E-154	ISS
GO:0006021	GO-bp	Annotation by Michelle Graham. GO Biological Process: inositol biosynthetic process	SoyBase	N/A	ISS
GO:0006790	GO-bp	Annotation by Michelle Graham. GO Biological Process: sulfur compound metabolic process	SoyBase	N/A	ISS
GO:0009409	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to cold	SoyBase	N/A	ISS
GO:0010264	GO-bp	Annotation by Michelle Graham. GO Biological Process: myo-inositol hexakisphosphate biosynthetic process	SoyBase	N/A	ISS
GO:0019243	GO-bp	Annotation by Michelle Graham. GO Biological Process: methylglyoxal catabolic process to D-lactate	SoyBase	N/A	ISS
GO:0019761	GO-bp	Annotation by Michelle Graham. GO Biological Process: glucosinolate biosynthetic process	SoyBase	N/A	ISS
GO:0019853	GO-bp	Annotation by Michelle Graham. GO Biological Process: L-ascorbic acid biosynthetic process	SoyBase	N/A	ISS
GO:0046854	GO-bp	Annotation by Michelle Graham. GO Biological Process: phosphatidylinositol phosphorylation	SoyBase	N/A	ISS
GO:0080167	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to karrikin	SoyBase	N/A	ISS
GO:0005737	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm	SoyBase	N/A	ISS
GO:0005829	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytosol	SoyBase	N/A	ISS
GO:0005886	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane	SoyBase	N/A	ISS
GO:0008441	GO-mf	Annotation by Michelle Graham. GO Molecular Function: 3'(2'),5'-bisphosphate nucleotidase activity	SoyBase	N/A	ISS
GO:0008934	GO-mf	Annotation by Michelle Graham. GO Molecular Function: inositol monophosphate 1-phosphatase activity	SoyBase	N/A	ISS
GO:0010347	GO-mf	Annotation by Michelle Graham. GO Molecular Function: L-galactose-1-phosphate phosphatase activity	SoyBase	N/A	ISS
KOG2951	KOG	Inositol monophosphatase	JGI		ISS
PTHR20854	Panther	INOSITOL MONOPHOSPHATASE	JGI		ISS
PTHR20854:SF4	Panther	MYO INOSITOL MONOPHOSPHATASE	JGI		ISS
PF00459	PFAM	Inositol monophosphatase family	JGI		ISS
UniRef100_C1LZ50	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: 3.1.2 inositol monophosphatase n=1 Tax=Phaseolus vulgaris RepID=C1LZ50_PHAVU	SoyBase	E_val: 0	ISS
UniRef100_I1L008	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1L008_SOYBN	SoyBase	E_val: 0	ISS

Expression Patterns of Glyma09g01380

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma09g01380

Paralog	Evidence	Comments
Glyma15g12230	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma09g01380 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.09g011100	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma09g01380

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma09g01380

Limit To All Plant Sequences

>Glyma09g01380.1   sequence type=CDS   gene model=Glyma09g01380   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGTTGACAATGAATCGCTCTCAGAATTCCTCGCATCTGCGGTCGACGCGGCTCAGAAAGCTGGCGAGATTATTCGAAAAGGCTTCTACCAGACCAAAAACGTCGAACACAAAGGACAGGTTGATTTGGTCACAGAAACTGATAAAGCATGTGAAGAACTCATATTTAATAATCTCAAACAGCTTTATCCCACTCACAAGTTCATCGGGGAAGAAACCACGGCTGCCTATGGCACCACAGAACTTACAGATGAACCCACGTGGATAGTTGATCCCCTGGATGGAACTACTAACTTTGTGCATGGGTTCCCCTTTGTTTGTGTCTCCATTGGTCTCACAATTGGAAAAACTCCTACGATTGGTGTTGTATACAATCCAATAATTAATGAGCTTTTTACTGGAATCCGTGGAAAAGGTGCCTTTTTGAATGGGAATCCCATAAAAGTATCGTCTCAAACTGAACTAATCAGCTCCCTTCTTGCAACTGAGGCCGGAACAAAACGTGACCAAGAAACAGTAGATGCCTCTACCAATAGGATTAAAAGCTTGCTTTTCAAGGTGAGATCTCTTCGAATGAGTGGCTCCTGCGCTCTGAATCTTTGTGGAATTGCATGTGGAAGGCTGGATGTATTCTTTGAACTTGGCTTTGGTGGTCCTTGGGATGTAGCAGGTGGTGCTGTCATTGTTAGAGAAGCTGGAGGTGTTGTATTTGATCCGTCCGGTGCAGATTTTGACATAACATCTCAGCGAGTAGCAGCTTCAAACTCTTTCTTAAAAGATGCACTTGTTGATACTCTGCGCCAAATGGTTTGA

Predicted protein sequences of Glyma09g01380

Limit To All Plant Sequences

>Glyma09g01380.1   sequence type=predicted peptide   gene model=Glyma09g01380   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MVDNESLSEFLASAVDAAQKAGEIIRKGFYQTKNVEHKGQVDLVTETDKACEELIFNNLKQLYPTHKFIGEETTAAYGTTELTDEPTWIVDPLDGTTNFVHGFPFVCVSIGLTIGKTPTIGVVYNPIINELFTGIRGKGAFLNGNPIKVSSQTELISSLLATEAGTKRDQETVDASTNRIKSLLFKVRSLRMSGSCALNLCGIACGRLDVFFELGFGGPWDVAGGAVIVREAGGVVFDPSGADFDITSQRVAASNSFLKDALVDTLRQMV*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain