Glyma08g20820 - SoyBase

SoyBase Follow us on Twitter @SoyBaseDatabase
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma08g20820

Feature Type:	gene_model
Chromosome:	Gm08
Start:	15796471
stop:	15798993
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma08g20820

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G17710	AT	Annotation by Michelle Graham. TAIR10: Pyridoxal phosphate phosphatase-related protein \| chr1:6090763-6091975 REVERSE LENGTH=279	SoyBase	E_val: 1.00E-135	ISS
GO:0008152	GO-bp	Annotation by Michelle Graham. GO Biological Process: metabolic process	SoyBase	N/A	ISS
GO:0016036	GO-bp	Annotation by Michelle Graham. GO Biological Process: cellular response to phosphate starvation	SoyBase	N/A	ISS
GO:0019375	GO-bp	Annotation by Michelle Graham. GO Biological Process: galactolipid biosynthetic process	SoyBase	N/A	ISS
GO:0045892	GO-bp	Annotation by Michelle Graham. GO Biological Process: negative regulation of transcription, DNA-dependent	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0016791	GO-mf	Annotation by Michelle Graham. GO Molecular Function: phosphatase activity	SoyBase	N/A	ISS
GO:0052731	GO-mf	Annotation by Michelle Graham. GO Molecular Function: phosphocholine phosphatase activity	SoyBase	N/A	ISS
GO:0052732	GO-mf	Annotation by Michelle Graham. GO Molecular Function: phosphoethanolamine phosphatase activity	SoyBase	N/A	ISS
KOG3120	KOG	Predicted haloacid dehalogenase-like hydrolase	JGI		ISS
PTHR20889	Panther	PHOSPHATASE, ORPHAN 1, 2	JGI		ISS
PF06888	PFAM	Putative Phosphatase	JGI		ISS
UniRef100_D7PEX6	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Haloacid dehalogenase n=1 Tax=Phaseolus vulgaris RepID=D7PEX6_PHAVU	SoyBase	E_val: 2.00E-173	ISS
UniRef100_I1KUW3	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KUW3_SOYBN	SoyBase	E_val: 0	ISS

Proteins Associated with Glyma08g20820

Locus	Gene Symbol	Protein Name
	ACP1	Acid phosphatase 1

Expression Patterns of Glyma08g20820

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma08g20820

Paralog	Evidence	Comments
Glyma07g01430	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma08g20820 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.08g195100	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma08g20820

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma08g20820

Limit To All Plant Sequences

>Glyma08g20820.1   sequence type=CDS   gene model=Glyma08g20820   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTCTGGAACCGTGATTGTTTTTGACTTTGACAAGACCATTGTCGATGTCGACAGTGACAACTGGGTCATCGACGAATTGGGTTTCACCGATTTGTTCAACCAGCTTCTTCCCACCATGCCTTGGAACTCTCTCATGGACAGGATGATGATGGAGCTTCATTCAAAAGGTAAGACCATAGAGGACATTGAAGAGGTTCTGCATAGGATTCCTTTGCACCCAAGAGTAATACCCGCTATTCAAGCAGCTCATGCTTTCGGGTGTGATTTGAGGATTGTGAGTGATGCAAACATGTTTTTCATTGAGACCATTCTGAAGCACTTGGGAATAAGGGAATACTTCTCGGAGATTAACACTAACCCAGGTTATGTTAACGAAGAAGGAAGGTTAAGGATTTTGCCTTACCATGACTTCAACAAAGCTTCCCATGGCTGCACTTTGTGTCCTCCAAATATGTGCAAGGGTTTAATCATTGATAGAATCCAAGATTCAATTTCACAAGAGGGTAACAAGAGGATGATCTATCTTGGTGATGGTAGTGGTGACTATTGCCCAAGCTTGAGGCTAAAAGAGAGAGACTATATGATGCCAAGGAAGAACTTTCCAGCGTGGGATTTGATATGCAAAGACCCTTTGCTTGTTAAGGCTGAAATTCATGGCTGGAGTGATGGAGAAGAGTTGGAGCAAGTTCTGTTGCACTTAATCGCCAAAATTTCAATGGAGGAAAATTCTCAGTTCATTTCATCTGATTGCAAGCTACAGACTCTCTCTGTCTCTGCTTTGGAGGGTTTGCCTAAAGTCCTCCCAGTTAGACCATAA

Predicted protein sequences of Glyma08g20820

Limit To All Plant Sequences

>Glyma08g20820.1   sequence type=predicted peptide   gene model=Glyma08g20820   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSGTVIVFDFDKTIVDVDSDNWVIDELGFTDLFNQLLPTMPWNSLMDRMMMELHSKGKTIEDIEEVLHRIPLHPRVIPAIQAAHAFGCDLRIVSDANMFFIETILKHLGIREYFSEINTNPGYVNEEGRLRILPYHDFNKASHGCTLCPPNMCKGLIIDRIQDSISQEGNKRMIYLGDGSGDYCPSLRLKERDYMMPRKNFPAWDLICKDPLLVKAEIHGWSDGEELEQVLLHLIAKISMEENSQFISSDCKLQTLSVSALEGLPKVLPVRP*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain