SoyBase Follow us on Twitter @SoyBaseDatabase
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma06g21383

Feature Type:gene_model
Chromosome:Gm06
Start:17957550
stop:17958802
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma06g21383
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G53700AT Annotation by Michelle Graham. TAIR10: Pentatricopeptide repeat (PPR) superfamily protein | chr3:19900303-19902567 FORWARD LENGTH=754 SoyBaseE_val: 9.00E-44ISS
GO:0009793GO-bp Annotation by Michelle Graham. GO Biological Process: embryo development ending in seed dormancy SoyBaseN/AISS
GO:0010027GO-bp Annotation by Michelle Graham. GO Biological Process: thylakoid membrane organization SoyBaseN/AISS
GO:0010228GO-bp Annotation by Michelle Graham. GO Biological Process: vegetative to reproductive phase transition of meristem SoyBaseN/AISS
GO:0016226GO-bp Annotation by Michelle Graham. GO Biological Process: iron-sulfur cluster assembly SoyBaseN/AISS
GO:0048481GO-bp Annotation by Michelle Graham. GO Biological Process: ovule development SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
PTHR24015Panther FAMILY NOT NAMED JGI ISS
PF01535PFAM PPR repeat JGI ISS
UniRef100_F8WLA5UniRef Annotation by Michelle Graham. Most informative UniRef hit: PPR containing protein n=1 Tax=Citrus unshiu RepID=F8WLA5_CITUN SoyBaseE_val: 3.00E-116ISS
UniRef100_I1JU03UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JU03_SOYBN SoyBaseE_val: 0ISS

Expression Patterns of Glyma06g21383
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma06g21383 not represented in the dataset
Glyma06g21383 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma06g21383 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.06g198200 Wm82.a2.v1IGC As supplied by JGI

References for Glyma06g21383
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma06g21383
>Glyma06g21383.1   sequence type=CDS   gene model=Glyma06g21383   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCCCTTCAATTCTTCAACTGGGCCTCCAACCACAACCACTACTCCTACACACCCTTCTACTATGCTGCCATCACCGACCTCTTGCTCTCCTACTCCTTCTCTGTCACTCCAACTGACTCTCCGACAACCTCGACGCTGTGTGTATTCTTGCAATTCCATATTGGGTGTCCTCGTGAGGGCCAACTATGTCAACATTGCCAAGGCCATCTACGATCAAGTTCTCACAGAAGCTATATTGGAACTTGATGTTTACACTTATACTACCATGATTTGTGGGTTATGCAAAGTGGGCATGGTCGAAAGTGCACGCAAGGTGTTTGAGGAAATTCCCTGCAAACCCAACATGGTTACTTACAACACGTTGATCCATGGGTTTTGTAAGAAAGGTGATATGGAGGGTGCCACGAGGCTTTTTGACAAATTGGTTGAGAATAAGAGTTGCAAGCCGGATGTGGAGTGTTTTACCACTTTGATTGAAGGGTATTCGAAGAGAAGTGATTTTCGAGATGCGCTTGAGTGCTTGAAGGAGATGATGGAAGGTCTATGTTTGAGCGGTGAAGCGGACGAGGCCAGGAAGATGATGAGTAGGATGCGGTTGAATGGTTTGAAAGAAGACGTTGCCACAAACACTAGCTTATTGAAAGGGTTTTGCATTTCTGATGAGACTGTTCAGCATTTGAGGGAAATGGTTAGTAGCGGGATGAAGCCAGATGTGAAAGCATATCGGGTTTTTGTCGTCAATGAGTATTGCAAGATTAGAAAACCAAGTGAAGCAGTGTTGCTTTTGTGGGAAATGATGGTGAGGGGTGTTAAGCCAAGTATGTCAAGCTTTAATGCAGTGTTTAGAGTTCTTGTGGATGAGGGGAAGCTTGATAAAGGAGTTCTTCTTTTGAAGCAGATGCCTAAGATGGGATGCCCGCCCAACTTCTTGTTTTATTGCATAGTGATATGTGGTCTTTGTAAAGTGAAGGGTAGGATGCAACAAGTTGAAGAGCTCATTTTGAATATGCTTCAGAATGGGCATAACCTGGATGCCACTATGTATAATTGCTTACTTGCGGGATATTGTGAAGACGGGGATGAAGAAATGACACCAAAGACAGTTATGACATAA
Predicted protein sequences of Glyma06g21383
>Glyma06g21383.1   sequence type=predicted peptide   gene model=Glyma06g21383   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MPFNSSTGPPTTTTTPTHPSTMLPSPTSCSPTPSLSLQLTLRQPRRCVYSCNSILGVLVRANYVNIAKAIYDQVLTEAILELDVYTYTTMICGLCKVGMVESARKVFEEIPCKPNMVTYNTLIHGFCKKGDMEGATRLFDKLVENKSCKPDVECFTTLIEGYSKRSDFRDALECLKEMMEGLCLSGEADEARKMMSRMRLNGLKEDVATNTSLLKGFCISDETVQHLREMVSSGMKPDVKAYRVFVVNEYCKIRKPSEAVLLLWEMMVRGVKPSMSSFNAVFRVLVDEGKLDKGVLLLKQMPKMGCPPNFLFYCIVICGLCKVKGRMQQVEELILNMLQNGHNLDATMYNCLLAGYCEDGDEEMTPKTVMT*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo