SoyBase Follow us on Twitter @SoyBaseDatabase
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma06g21320

Feature Type:gene_model
Chromosome:Gm06
Start:17899290
stop:17900048
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma06g21320
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G25400AT Annotation by Michelle Graham. TAIR10: CONTAINS InterPro DOMAIN/s: NTP Pyrophosphohydrolase MazG-related, RS21-C6 (InterPro:IPR011394), EAR (InterPro:IPR009039), NTP pyrophosphohydrolase MazG, putative catalytic core (InterPro:IPR004518); Has 1123 Blast hits to 1121 proteins in 452 species: Archae - 22; Bacteria - 753; Metazoa - 81; Fungi - 3; Plants - 83; Viruses - 0; Other Eukaryotes - 181 (source: NCBI BLink). | chr3:9213236-9214144 FORWARD LENGTH=141 SoyBaseE_val: 1.00E-46ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
PTHR14552Panther FAMILY NOT NAMED JGI ISS
PF03819PFAM MazG nucleotide pyrophosphohydrolase domain JGI ISS
UniRef100_B6SRV4UniRef Annotation by Michelle Graham. Most informative UniRef hit: MazG nucleotide pyrophosphohydrolase domain protein n=1 Tax=Zea mays RepID=B6SRV4_MAIZE SoyBaseE_val: 2.00E-45ISS
UniRef100_C6T380UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6T380_SOYBN SoyBaseE_val: 3.00E-90ISS

Expression Patterns of Glyma06g21320
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma06g21320 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.06g197800 Wm82.a2.v1IGC As supplied by JGI

References for Glyma06g21320
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma06g21320
>Glyma06g21320.2   sequence type=CDS   gene model=Glyma06g21320   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCATAGCATTTGGATGAAGCATGAGTTAGAGATAAAAACCAGAAAAGGAGATATGGATTGCTCTTATGGTTTTCCCATAACACGTCCAAGAGATGTTTCTCTTCAGGAACTAAGCAAGAGGCTGGCCGAGTTTGCTGAAGTGAGAGGATGGGATCAACATCACAGTCCTAGAAATCTTCTCTTAGCACTTGTTGGAGAGGTGGGAGAGCTGTCTGAGATATTCCAATGGAAAGGAGAAGTTGCAAAAGGATTACCCAATTGGAGTTCTGATGACAAGGAAAGGTTAGAGGAAGAACTTTCAGATGTTTTGTTGTATTTGGTGCGTCTTGCTGATGTGTGTGGCCTAGATCTTGGACAAGCAGCTCTAACAAAATTGGTCAAGAATGCTCAGAAATACCCTGTTGTTGTTACTAACAACACACCCTCTTCAACAACCATGAATTGA
Predicted protein sequences of Glyma06g21320
>Glyma06g21320.2   sequence type=predicted peptide   gene model=Glyma06g21320   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MHSIWMKHELEIKTRKGDMDCSYGFPITRPRDVSLQELSKRLAEFAEVRGWDQHHSPRNLLLALVGEVGELSEIFQWKGEVAKGLPNWSSDDKERLEEELSDVLLYLVRLADVCGLDLGQAALTKLVKNAQKYPVVVTNNTPSSTTMN*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo