Glyma05g38130 - SoyBase

SoyBase Follow us on Twitter @SoyBaseDatabase
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma05g38130

Feature Type:	gene_model
Chromosome:	Gm05
Start:	41535463
stop:	41536369
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma05g38130

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT4G11650	AT	Annotation by Michelle Graham. TAIR10: osmotin 34 \| chr4:7025127-7026113 REVERSE LENGTH=244	SoyBase	E_val: 5.00E-106	ISS
GO:0009651	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to salt stress	SoyBase	N/A	ISS
GO:0009816	GO-bp	Annotation by Michelle Graham. GO Biological Process: defense response to bacterium, incompatible interaction	SoyBase	N/A	ISS
GO:0009817	GO-bp	Annotation by Michelle Graham. GO Biological Process: defense response to fungus, incompatible interaction	SoyBase	N/A	ISS
GO:0051707	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to other organism	SoyBase	N/A	ISS
GO:0005576	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: extracellular region	SoyBase	N/A	ISS
PF00314	PFAM	Thaumatin family	JGI		ISS
UniRef100_I1K6M9	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1K6M9_SOYBN	SoyBase	E_val: 1.00E-160	ISS
UniRef100_P25096	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Protein P21 n=1 Tax=Glycine max RepID=P21_SOYBN	SoyBase	E_val: 9.00E-143	ISS

Expression Patterns of Glyma05g38130

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma05g38130 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.05g204600	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma05g38130

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma05g38130

Limit To All Plant Sequences

>Glyma05g38130.1   sequence type=CDS   gene model=Glyma05g38130   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCGGCTCTCAGAAAAGCCGTGTTCTTTGTAATCGCTCAATGCTTCACCTTTTCCGCATATGCTGCAAGGTTTGAAATCACAAACCGATGCACATACACTGTCTGGGCTGCGTCTGTGCCTGTTGGCGGTGGCGTGCAATTAAACCCGGGCCAGTCATGGTCCGTGGACGTGCCTGCAGGAACGAAAGGGGCCCGCGTTTGGGCCCGAACCGGCTGCAACTTCGACGGTTCGGGCCGCGGTGGATGCCAGACCGGTGACTGCGGGGGTGTCCTCGACTGCAAAGCTTACGGTGCGCCTCCCAACACCCTGGCTGAATACGGCCTGAACGGGTTCAACAATTTGGACTTCTTCGACATCTCCCTCGTCGACGGTTTTAACGTGCCCATGGACTTTAGTCCAACCTCGAATGGATGCACACGTGGCATAAGCTGCACTGCGGACATTAACGGACAGTGCCCTAGTGAGCTAAAGACTCAAGGAGGTTGCAACAACCCTTGCACTGTCTTCAAAACCGACCAGTACTGTTGCAATTCCGGTAGCTGTGGGCCCACTGATTATTCCAGATTCTTCAAGCAAAGGTGCCCCGATGCTTATAGTTACCCCAAGGATGATCCAACTAGCACCTTCACTTGTAATGGTGGGACTGACTATAGGGTTGTCTTTTGTCCTTGA

Predicted protein sequences of Glyma05g38130

Limit To All Plant Sequences

>Glyma05g38130.1   sequence type=predicted peptide   gene model=Glyma05g38130   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAALRKAVFFVIAQCFTFSAYAARFEITNRCTYTVWAASVPVGGGVQLNPGQSWSVDVPAGTKGARVWARTGCNFDGSGRGGCQTGDCGGVLDCKAYGAPPNTLAEYGLNGFNNLDFFDISLVDGFNVPMDFSPTSNGCTRGISCTADINGQCPSELKTQGGCNNPCTVFKTDQYCCNSGSCGPTDYSRFFKQRCPDAYSYPKDDPTSTFTCNGGTDYRVVFCP*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain