SoyBase Follow us on Twitter @SoyBaseDatabase
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma04g40150

Feature Type:gene_model
Chromosome:Gm04
Start:46283933
stop:46287471
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma04g40150
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G38560AT Annotation by Michelle Graham. TAIR10: transcript elongation factor IIS | chr2:16134802-16136319 FORWARD LENGTH=378 SoyBaseE_val: 2.00E-120ISS
GO:0000394GO-bp Annotation by Michelle Graham. GO Biological Process: RNA splicing, via endonucleolytic cleavage and ligation SoyBaseN/AISS
GO:0006351GO-bp Annotation by Michelle Graham. GO Biological Process: transcription, DNA-dependent SoyBaseN/AISS
GO:0006354GO-bp Annotation by Michelle Graham. GO Biological Process: DNA-dependent transcription, elongation SoyBaseN/AISS
GO:0006355GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0006357GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of transcription from RNA polymerase II promoter SoyBaseN/AISS
GO:0006366GO-bp Annotation by Michelle Graham. GO Biological Process: transcription from RNA polymerase II promoter SoyBaseN/AISS
GO:0007062GO-bp Annotation by Michelle Graham. GO Biological Process: sister chromatid cohesion SoyBaseN/AISS
GO:0009640GO-bp Annotation by Michelle Graham. GO Biological Process: photomorphogenesis SoyBaseN/AISS
GO:0009739GO-bp Annotation by Michelle Graham. GO Biological Process: response to gibberellin stimulus SoyBaseN/AISS
GO:0009793GO-bp Annotation by Michelle Graham. GO Biological Process: embryo development ending in seed dormancy SoyBaseN/AISS
GO:0009845GO-bp Annotation by Michelle Graham. GO Biological Process: seed germination SoyBaseN/AISS
GO:0009880GO-bp Annotation by Michelle Graham. GO Biological Process: embryonic pattern specification SoyBaseN/AISS
GO:0009909GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of flower development SoyBaseN/AISS
GO:0009910GO-bp Annotation by Michelle Graham. GO Biological Process: negative regulation of flower development SoyBaseN/AISS
GO:0009933GO-bp Annotation by Michelle Graham. GO Biological Process: meristem structural organization SoyBaseN/AISS
GO:0010072GO-bp Annotation by Michelle Graham. GO Biological Process: primary shoot apical meristem specification SoyBaseN/AISS
GO:0010162GO-bp Annotation by Michelle Graham. GO Biological Process: seed dormancy process SoyBaseN/AISS
GO:0010182GO-bp Annotation by Michelle Graham. GO Biological Process: sugar mediated signaling pathway SoyBaseN/AISS
GO:0010228GO-bp Annotation by Michelle Graham. GO Biological Process: vegetative to reproductive phase transition of meristem SoyBaseN/AISS
GO:0010431GO-bp Annotation by Michelle Graham. GO Biological Process: seed maturation SoyBaseN/AISS
GO:0010564GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of cell cycle process SoyBaseN/AISS
GO:0016567GO-bp Annotation by Michelle Graham. GO Biological Process: protein ubiquitination SoyBaseN/AISS
GO:0019915GO-bp Annotation by Michelle Graham. GO Biological Process: lipid storage SoyBaseN/AISS
GO:0032784GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of DNA-dependent transcription, elongation SoyBaseN/AISS
GO:0034243GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of transcription elongation from RNA polymerase II promoter SoyBaseN/AISS
GO:0045595GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of cell differentiation SoyBaseN/AISS
GO:0048366GO-bp Annotation by Michelle Graham. GO Biological Process: leaf development SoyBaseN/AISS
GO:0048825GO-bp Annotation by Michelle Graham. GO Biological Process: cotyledon development SoyBaseN/AISS
GO:0050826GO-bp Annotation by Michelle Graham. GO Biological Process: response to freezing SoyBaseN/AISS
GO:0051301GO-bp Annotation by Michelle Graham. GO Biological Process: cell division SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
GO:0003676GO-mf Annotation by Michelle Graham. GO Molecular Function: nucleic acid binding SoyBaseN/AISS
GO:0003677GO-mf Annotation by Michelle Graham. GO Molecular Function: DNA binding SoyBaseN/AISS
GO:0003700GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity SoyBaseN/AISS
GO:0003746GO-mf Annotation by Michelle Graham. GO Molecular Function: translation elongation factor activity SoyBaseN/AISS
GO:0008270GO-mf Annotation by Michelle Graham. GO Molecular Function: zinc ion binding SoyBaseN/AISS
KOG1105 KOG Transcription elongation factor TFIIS/Cofactor of enhancer-binding protein Sp1 JGI ISS
PTHR11477Panther TRANSCRIPTION ELONGATION FACTOR S-II JGI ISS
PF01096PFAM Transcription factor S-II (TFIIS) JGI ISS
PF07500PFAM Transcription factor S-II (TFIIS), central domain JGI ISS
PF08711PFAM TFIIS helical bundle-like domain JGI ISS
UniRef100_B9SRT6UniRef Annotation by Michelle Graham. Most informative UniRef hit: Transcription elongation factor s-II, putative n=1 Tax=Ricinus communis RepID=B9SRT6_RICCO SoyBaseE_val: 3.00E-137ISS
UniRef100_I1JYC9UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1JYC9_SOYBN SoyBaseE_val: 0ISS

Expression Patterns of Glyma04g40150
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma04g40150
ParalogEvidenceComments
Glyma06g14690 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma04g40150 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.04g223500 Wm82.a2.v1IGC As supplied by JGI

References for Glyma04g40150
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma04g40150
>Glyma04g40150.1   sequence type=CDS   gene model=Glyma04g40150   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTTCTCTTCCTCTCACTTGCCACACCACCGCCGCCGCAGGAGACAACAACAACAACAACACGTTCCATTCTCGAGGAGAGAGTGGTTGGGTTCGATGGAGAAGGAGTTGGTGGAATTGTACGAAGCGGCGAAGAAGGCGGCGGATGCTGCCATCTCCGGCGACGGCAAACATGAGGAAAGCCGATGCATCGATGCGCTCGAGCAGCTCAAGAAGTTTCCCGTTAATTACAAGATTCTCGTCAACACCCAGGTGGGTAAACATCTTAAAGTTTTGACAAAGCACCCGAGGCTGAAAATTAAGGCCTTTGCTATTGACCTAATTGAGATATGGAAAGGCATAATTATCAAGGAAACAAGCAAAAATAAAAATGGGGGCTCTGATAGTAAGGTTGAGTCGGCTAATGGGGAGAAATCTAAAGCTGGGAAAATGCAAAAGAGTCCTTCGGTAAAGGTTGAAAAAGGTGAAACTGTTAAGGTTGAGAAAATTGATAGGAATGGTACAACAAAGTCAAGCTCAGAAAATATGAAAAAGGTACAAAACGATGTCAAGAATGAGAAAACTGATCGTTCTGCAAGTGTCAAGGTGGAAAAGATAGCCAAGGAGGAAAAGCCAGTTTCTGGAGCAAAGAAAATGTCATCCAGTTCTGCCGCTCCCCCAAAACTAAAAACTATGATTAAATCTAATGATGCAACACGAGACAAAATAAGGGAAATTCTCCACGAGGCTTTATCCAAGGTTACTGGAGAAGCTGATGAAGATCTTGTAGATGTAGTCAATAATTCTGATCCTATCCGTGTTGCTGTGACAGTGGAGTCTGTATTATTTGAAAAATGGGGCCCTTCTAATGGGGCACAAAAGGTCAAGTATAGGTCCTTAATGTTTAACCTTAAGGATTCAAACAACCCTGATTTCCGGAGAAAAGTTCTGCTTGGTGTTATTGAGCCAGAGCAACTGATCAACATGAGCACAGCAGAAATGGCTAGTGAGCAAAGGAAGCAGGAATATCAGAAAATCACAGAGAAAGCTTTGTTTGAATGTGAGCGTGGAGGTCCGCCAAAAGCTACAACCGATCAATTTAAGTGTGGCCGATGTGGTCAAAGAAAGACCACCTATTACCAAATGCAGACTCGCAGTGCTGATGAACCTATGACAACCTATGTCACTTGTGTTGTCTGCAATAACCGTTGGAAGTTCTGTTAG
Predicted protein sequences of Glyma04g40150
>Glyma04g40150.1   sequence type=predicted peptide   gene model=Glyma04g40150   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MFSSSHLPHHRRRRRQQQQQHVPFSRREWLGSMEKELVELYEAAKKAADAAISGDGKHEESRCIDALEQLKKFPVNYKILVNTQVGKHLKVLTKHPRLKIKAFAIDLIEIWKGIIIKETSKNKNGGSDSKVESANGEKSKAGKMQKSPSVKVEKGETVKVEKIDRNGTTKSSSENMKKVQNDVKNEKTDRSASVKVEKIAKEEKPVSGAKKMSSSSAAPPKLKTMIKSNDATRDKIREILHEALSKVTGEADEDLVDVVNNSDPIRVAVTVESVLFEKWGPSNGAQKVKYRSLMFNLKDSNNPDFRRKVLLGVIEPEQLINMSTAEMASEQRKQEYQKITEKALFECERGGPPKATTDQFKCGRCGQRKTTYYQMQTRSADEPMTTYVTCVVCNNRWKFC*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo