Report for Sequence Feature Glyma02g13420
Feature Type: gene_model
Chromosome: Gm02
Start: 11748591
stop: 11753085
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma02g13420
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT1G69120 AT
Annotation by Michelle Graham. TAIR10: K-box region and MADS-box transcription factor family protein | chr1:25982576-25986102 REVERSE LENGTH=256
SoyBase E_val: 4.00E-106 ISS
GO:0006355 GO-bp
Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent
SoyBase N/A ISS
GO:0009556 GO-bp
Annotation by Michelle Graham. GO Biological Process: microsporogenesis
SoyBase N/A ISS
GO:0009827 GO-bp
Annotation by Michelle Graham. GO Biological Process: plant-type cell wall modification
SoyBase N/A ISS
GO:0009860 GO-bp
Annotation by Michelle Graham. GO Biological Process: pollen tube growth
SoyBase N/A ISS
GO:0009886 GO-bp
Annotation by Michelle Graham. GO Biological Process: post-embryonic morphogenesis
SoyBase N/A ISS
GO:0009908 GO-bp
Annotation by Michelle Graham. GO Biological Process: flower development
SoyBase N/A ISS
GO:0009909 GO-bp
Annotation by Michelle Graham. GO Biological Process: regulation of flower development
SoyBase N/A ISS
GO:0009933 GO-bp
Annotation by Michelle Graham. GO Biological Process: meristem structural organization
SoyBase N/A ISS
GO:0010076 GO-bp
Annotation by Michelle Graham. GO Biological Process: maintenance of floral meristem identity
SoyBase N/A ISS
GO:0010093 GO-bp
Annotation by Michelle Graham. GO Biological Process: specification of floral organ identity
SoyBase N/A ISS
GO:0010582 GO-bp
Annotation by Michelle Graham. GO Biological Process: floral meristem determinacy
SoyBase N/A ISS
GO:0045893 GO-bp
Annotation by Michelle Graham. GO Biological Process: positive regulation of transcription, DNA-dependent
SoyBase N/A ISS
GO:0048440 GO-bp
Annotation by Michelle Graham. GO Biological Process: carpel development
SoyBase N/A ISS
GO:0048441 GO-bp
Annotation by Michelle Graham. GO Biological Process: petal development
SoyBase N/A ISS
GO:0048443 GO-bp
Annotation by Michelle Graham. GO Biological Process: stamen development
SoyBase N/A ISS
GO:0048481 GO-bp
Annotation by Michelle Graham. GO Biological Process: ovule development
SoyBase N/A ISS
GO:0048507 GO-bp
Annotation by Michelle Graham. GO Biological Process: meristem development
SoyBase N/A ISS
GO:0052543 GO-bp
Annotation by Michelle Graham. GO Biological Process: callose deposition in cell wall
SoyBase N/A ISS
GO:0005634 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: nucleus
SoyBase N/A ISS
GO:0003677 GO-mf
Annotation by Michelle Graham. GO Molecular Function: DNA binding
SoyBase N/A ISS
GO:0003700 GO-mf
Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity
SoyBase N/A ISS
GO:0005515 GO-mf
Annotation by Michelle Graham. GO Molecular Function: protein binding
SoyBase N/A ISS
GO:0046982 GO-mf
Annotation by Michelle Graham. GO Molecular Function: protein heterodimerization activity
SoyBase N/A ISS
KOG0014
KOG
MADS box transcription factor
JGI ISS
PTHR11945 Panther
MADS BOX PROTEIN
JGI ISS
PTHR11945:SF19 Panther
MADS BOX PROTEIN
JGI ISS
PF00319 PFAM
SRF-type transcription factor (DNA-binding and dimerisation domain)
JGI ISS
PF01486 PFAM
K-box region
JGI ISS
UniRef100_E1CKY3 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: APETALA1 n=1 Tax=Vigna unguiculata RepID=E1CKY3_VIGUN
SoyBase E_val: 7.00E-137 ISS
UniRef100_I1JEI8 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JEI8_SOYBN
SoyBase E_val: 4.00E-180 ISS
Expression Patterns of Glyma02g13420
Gene expression representations made with eFP at the University of Toronto. Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE Paralogs of Glyma02g13420
Paralog Evidence Comments
Glyma01g08150 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma02g13420 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.02g121600 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma02g13420
Coding sequences of Glyma02g13420
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma02g13420.1 sequence type=CDS gene model=Glyma02g13420 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGGGAAGAGGTAGGGTACAGCTGAAGAGGATAGAGAACAAGATCAATCGCCAGGTAACTTTCTCCAAAAGGAGAGGTGGGTTGCTCAAGAAAGCTCATGAAATATCTGTACTCTGTGATGCTGAGGTAGCTTTGATTATCTTCTCTCACAAAGGAAAGCTCTTTGAGTATGCTACTGATTCATGCATGGAGAAGATACTGGAACGCCATGAAAGGTATGCCTATGCAGAGAGGCAGCTAGTAGCAAATGATTCTGAGACACAGGAAAACTGGACCATTGAATACACTAGACTGAAGGCAAAAATTGACCTTTTACAGAGAAACCACAGGCACTATATGGGAGAAGATTTGGCTTCAATGAGCCTCAAAGAGCTTCAGAGTTTGGAGCAGCAGTTGGTTACTGGTATCAAAAACATCCGCACAAGGAGGAATGATCTCATGTCCGAGTCCATTTCTGAGCTTCAGAAAAAGGAGAAAAGGATACAAGAGGAGAATAACACCCTTGCAAAGAAGATCAAGGAGAAAGAGCAGGCTGTAGCACAGCAAGCTGCACAATGGGAGCAGCCAAACTACAGGGTTGATACATCTTTCATGCCACAGCAGCAACCCCTTCCCACCAGTTTGAACATATGTGGCAATAATTACTGCCAGGAAGCTGCACCAGAACTAGGAAGGAACGGTCTAGACCTGACCCTGGAACCACTCTATTCTTGCAACCTTGGATGCTTCTGA
Predicted protein sequences of Glyma02g13420
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma02g13420.1 sequence type=predicted peptide gene model=Glyma02g13420 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MGRGRVQLKRIENKINRQVTFSKRRGGLLKKAHEISVLCDAEVALIIFSHKGKLFEYATDSCMEKILERHERYAYAERQLVANDSETQENWTIEYTRLKAKIDLLQRNHRHYMGEDLASMSLKELQSLEQQLVTGIKNIRTRRNDLMSESISELQKKEKRIQEENNTLAKKIKEKEQAVAQQAAQWEQPNYRVDTSFMPQQQPLPTSLNICGNNYCQEAAPELGRNGLDLTLEPLYSCNLGCF*
SoyBase
Follow us on Twitter @SoyBaseDatabase
