SoyBase Follow us on Twitter @SoyBaseDatabase
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma02g13401

Feature Type:gene_model
Chromosome:Gm02
Start:11729655
stop:11746942
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma02g13401
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G15800AT Annotation by Michelle Graham. TAIR10: K-box region and MADS-box transcription factor family protein | chr5:5151594-5153767 REVERSE LENGTH=251 SoyBaseE_val: 3.00E-95ISS
GO:0006355GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0009827GO-bp Annotation by Michelle Graham. GO Biological Process: plant-type cell wall modification SoyBaseN/AISS
GO:0009860GO-bp Annotation by Michelle Graham. GO Biological Process: pollen tube growth SoyBaseN/AISS
GO:0009886GO-bp Annotation by Michelle Graham. GO Biological Process: post-embryonic morphogenesis SoyBaseN/AISS
GO:0009908GO-bp Annotation by Michelle Graham. GO Biological Process: flower development SoyBaseN/AISS
GO:0009909GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of flower development SoyBaseN/AISS
GO:0010048GO-bp Annotation by Michelle Graham. GO Biological Process: vernalization response SoyBaseN/AISS
GO:0010093GO-bp Annotation by Michelle Graham. GO Biological Process: specification of floral organ identity SoyBaseN/AISS
GO:0043481GO-bp Annotation by Michelle Graham. GO Biological Process: anthocyanin accumulation in tissues in response to UV light SoyBaseN/AISS
GO:0048440GO-bp Annotation by Michelle Graham. GO Biological Process: carpel development SoyBaseN/AISS
GO:0048441GO-bp Annotation by Michelle Graham. GO Biological Process: petal development SoyBaseN/AISS
GO:0048443GO-bp Annotation by Michelle Graham. GO Biological Process: stamen development SoyBaseN/AISS
GO:0048481GO-bp Annotation by Michelle Graham. GO Biological Process: ovule development SoyBaseN/AISS
GO:0048507GO-bp Annotation by Michelle Graham. GO Biological Process: meristem development SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003677GO-mf Annotation by Michelle Graham. GO Molecular Function: DNA binding SoyBaseN/AISS
GO:0003700GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
GO:0046983GO-mf Annotation by Michelle Graham. GO Molecular Function: protein dimerization activity SoyBaseN/AISS
KOG0014 KOG MADS box transcription factor JGI ISS
PTHR11945Panther MADS BOX PROTEIN JGI ISS
PTHR11945:SF19Panther MADS BOX PROTEIN JGI ISS
PF00319PFAM SRF-type transcription factor (DNA-binding and dimerisation domain) JGI ISS
PF01486PFAM K-box region JGI ISS
UniRef100_I1J645UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1J645_SOYBN SoyBaseE_val: 3.00E-162ISS
UniRef100_Q8LLR2UniRef Annotation by Michelle Graham. Most informative UniRef hit: MADS-box protein 2 n=1 Tax=Vitis vinifera RepID=Q8LLR2_VITVI SoyBaseE_val: 5.00E-106ISS

Expression Patterns of Glyma02g13401
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma02g13401 not represented in the dataset
Glyma02g13401 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma02g13401
ParalogEvidenceComments
Glyma01g08130 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma02g13401 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.02g121500 Wm82.a2.v1IGC As supplied by JGI

References for Glyma02g13401
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma02g13401
>Glyma02g13401.1   sequence type=CDS   gene model=Glyma02g13401   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGTAGGGGAAAGGTGGAGCTGAAGAGGATTGAGAACAAGATAAACCGTCAAGTGACATTTGCAAAGAGGAGGAATGGTTTGCTCAAAAAGGCTTATGAACTCTCTGTCCTCTGTGATGCTGAGGTTGCCCTTATTATCTTCTCCAACCGTGGCAAGCTGTATGAGTTCTGCAGCGGCCATAGCATGGCCAAGACACTTGAACGGTATCACAGATGCAGTTATGGAGCCTTGGAAGTCCAGCACCAACCTGAAATAGAGACACAGAGGCGCTACCAAGAGTACCTGAAGCTAAAATCCAGAGTTGAGGCACTACAGCAAACACAAAGAAACCTCCTTGGGGAAGAATTGGAGCACTTAGACGTTAAGGACCTTGAGCAGCTTGAACGTCAGCTGGACTCTTCCCTGAAGCAAATCAGGTCAAACAAGACACAACAAATGCTCGATCAACTCGCTGATTTGCATAGAAAGGAAGAGATGCTACTGGAGACTAACAATATCCTGAGGAACAAGTTGGAGGAAATCAATGTAGCCCTTCAACCAACATGGGAAACTAGGGAGCAAAATGCTCCATACAATTACCACCCTTCCCAATCAGAGGGATATTATGAGACAGCACATTGCAACAGTACATTGCGAATTGGCTATGATTCTTCAGGGTTAAATGAAGCAGGAGGAGCTGCAGGAACCTCAGCCCAAAATGCTAGTGAATTCATGAATGGATGGATGAACTAA
Predicted protein sequences of Glyma02g13401
>Glyma02g13401.1   sequence type=predicted peptide   gene model=Glyma02g13401   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSGHSMAKTLERYHRCSYGALEVQHQPEIETQRRYQEYLKLKSRVEALQQTQRNLLGEELEHLDVKDLEQLERQLDSSLKQIRSNKTQQMLDQLADLHRKEEMLLETNNILRNKLEEINVALQPTWETREQNAPYNYHPSQSEGYYETAHCNSTLRIGYDSSGLNEAGGAAGTSAQNASEFMNGWMN*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo