Glyma01g02171 - SoyBase

SoyBase Follow us on Twitter @SoyBaseDatabase
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma01g02171

Feature Type:	gene_model
Chromosome:	Gm01
Start:	1673103
stop:	1673545
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma01g02171

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT2G19580	AT	Annotation by Michelle Graham. TAIR10: tetraspanin2 \| chr2:8472393-8475021 REVERSE LENGTH=270	SoyBase	E_val: 7.00E-36	ISS
GO:0007568	GO-bp	Annotation by Michelle Graham. GO Biological Process: aging	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0016021	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: integral to membrane	SoyBase	N/A	ISS
GO:0003674	GO-mf	Annotation by Michelle Graham. GO Molecular Function: molecular function	SoyBase	N/A	ISS
PTHR19282	Panther	TETRASPANIN	JGI		ISS
PTHR19282:SF137	Panther		JGI		ISS
PF00335	PFAM	Tetraspanin family	JGI		ISS
UniRef100_B4FDE7	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Senescence-associated protein 5 n=1 Tax=Zea mays RepID=B4FDE7_MAIZE	SoyBase	E_val: 4.00E-23	ISS
UniRef100_I1J4U9	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=1 Tax=Glycine max RepID=I1J4U9_SOYBN	SoyBase	E_val: 2.00E-45	ISS

Expression Patterns of Glyma01g02171

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma01g02171 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.01g017600	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma01g02171

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma01g02171

Limit To All Plant Sequences

>Glyma01g02171.1   sequence type=CDS   gene model=Glyma01g02171   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGATTGCCTGCAATGGAGCAACGACCAAACACAACTTTGCTACAACTGCGACTCGTGCAAGGCCGGTTTATTGGCAAATCTTAGGAAGGAGTGGAGAAGGGCCAATGTGATATTAATCATCACAGTCATTGTTTTAATAATTGTGTATTTGGTAGGGTGCTGTGCCTTTAGGAATGTCAAAACTGAGGACCTCTTCCGCAAATACAAACAAGGCTACACTTGA

Predicted protein sequences of Glyma01g02171

Limit To All Plant Sequences

>Glyma01g02171.1   sequence type=predicted peptide   gene model=Glyma01g02171   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MDCLQWSNDQTQLCYNCDSCKAGLLANLRKEWRRANVILIITVIVLIIVYLVGCCAFRNVKTEDLFRKYKQGYT*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain