Glyma01g00820 - SoyBase

SoyBase Follow us on Twitter @SoyBaseDatabase
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma01g00820

Feature Type:	gene_model
Chromosome:	Gm01
Start:	464652
stop:	466721
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma01g00820

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT2G19810	AT	Annotation by Michelle Graham. TAIR10: CCCH-type zinc finger family protein \| chr2:8550419-8551498 FORWARD LENGTH=359	SoyBase	E_val: 1.00E-131	ISS
GO:0006355	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent	SoyBase	N/A	ISS
GO:0006661	GO-bp	Annotation by Michelle Graham. GO Biological Process: phosphatidylinositol biosynthetic process	SoyBase	N/A	ISS
GO:0006979	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to oxidative stress	SoyBase	N/A	ISS
GO:0015996	GO-bp	Annotation by Michelle Graham. GO Biological Process: chlorophyll catabolic process	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0005886	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane	SoyBase	N/A	ISS
GO:0003676	GO-mf	Annotation by Michelle Graham. GO Molecular Function: nucleic acid binding	SoyBase	N/A	ISS
GO:0003700	GO-mf	Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity	SoyBase	N/A	ISS
GO:0008270	GO-mf	Annotation by Michelle Graham. GO Molecular Function: zinc ion binding	SoyBase	N/A	ISS
KOG1595	KOG	CCCH-type Zn-finger protein	JGI		ISS
PTHR14493	Panther	UNKEMPT-RELATED	JGI		ISS
PF00642	PFAM	Zinc finger C-x8-C-x5-C-x3-H type (and similar)	JGI		ISS
UniRef100_E1U3U6	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Zinc finger protein ZF3 n=1 Tax=Cicer arietinum RepID=E1U3U6_CICAR	SoyBase	E_val: 1.00E-165	ISS
UniRef100_I1J4E8	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1J4E8_SOYBN	SoyBase	E_val: 0	ISS

Expression Patterns of Glyma01g00820

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma01g00820

Paralog	Evidence	Comments
Glyma07g15240	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma01g00820 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.01g005000	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma01g00820

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma01g00820

Limit To All Plant Sequences

>Glyma01g00820.1   sequence type=CDS   gene model=Glyma01g00820   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGATGCTCGGAGAACACCATCGCGGGAATCCGACGGTCCTCGTGCCACCGTGGCCAGCCCACGACGATCCGACGGCTGAGATGTACTCCGCGTTCTTAACAAACGACGTCAATGCTGGTGAGTACTCTCCGTACCATCTTCAAGAAGCACTAACGGCGCTGCAGCGTTTTCTGCCGTCAAACGAAACGGACGCAGACTCGGACTCCTCGGAGGCGGCTCAGCCCGACGCGGCGGTGGACGCGTACACGTGCGACCATTTCCGCATGTACGAGTTCAAGGTCCGTCGATGCGCACGTGGCAGGTCACACGACTGGACGGAGTGTCCGTACGCGCATCCCGGCGAGAAGGCCCGCCGCCGTGACCCGCGGAGGTTCCACTACTCTGGCGTGGCGTGCCCGGAGTTCCGCAAGGGAAACTGCAGGAAAGGCGACGCGTGCGAGTTCGCGCACGGCGTTTTCGAGTGCTGGCTCCATCCGGCGCGCTACCGGACTCAGCCATGCAAGGACGGCACGAGCTGCCGGCGGCGCGTGTGCTTCTTCGCGCACACGCCGGAGCAGCTGCGCGTCCTGCCGATGCAGAGTCCGCGTAGCGTGGCAAACTCATCGGAGTCCTACGACGGGTCTCCGATGAGGCAGGTTTCGTTGTCGTCGGCGGCGGCGGCGGCGTTCATGTCTTCTCCGGCGGCTTCTCTCTCTCCGCCAGAGTCGCCGCCATCGGTGAACGAGATGGTGGCTTCTCTGCGTAATTTGCAGCTTGGGAAAATGAAATCGATGCCTCATAATAGAAACGTGTCGGTCGGGTCGCCGAGGGGATCGGTACTCCGACCGGGTTTTTTAAGCCTTCCAACAACGCCAACTCAGCAACCGGTTCGGTCTGGGGTGAAGTGTTTTGATGTTTGGGATGAGAGTTTTGAGGAGGAACCGGTTATGGAGAGGGTGGAGTCAGGGAGGGGAATAAGGGCTAAGATGTTTGAGAAGCTCAGCAAGGAGAATTCACTCGACGCCTCGGCTTCGCCTCCGGATCTTGGGTGGGTCTCGGAGCTTGTTAAGTGA

Predicted protein sequences of Glyma01g00820

Limit To All Plant Sequences

>Glyma01g00820.1   sequence type=predicted peptide   gene model=Glyma01g00820   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MMLGEHHRGNPTVLVPPWPAHDDPTAEMYSAFLTNDVNAGEYSPYHLQEALTALQRFLPSNETDADSDSSEAAQPDAAVDAYTCDHFRMYEFKVRRCARGRSHDWTECPYAHPGEKARRRDPRRFHYSGVACPEFRKGNCRKGDACEFAHGVFECWLHPARYRTQPCKDGTSCRRRVCFFAHTPEQLRVLPMQSPRSVANSSESYDGSPMRQVSLSSAAAAAFMSSPAASLSPPESPPSVNEMVASLRNLQLGKMKSMPHNRNVSVGSPRGSVLRPGFLSLPTTPTQQPVRSGVKCFDVWDESFEEEPVMERVESGRGIRAKMFEKLSKENSLDASASPPDLGWVSELVK*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain