SoyBase Follow us on Twitter @SoyBaseDatabase
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma.19g194300

Feature Type:gene_model
Chromosome:Gm19
Start:45183357
stop:45185175
Source:JGI
Version:Wm82.a2.v1
High confidence:yes



A previous version of this gene model can be found here:

Annotations for Glyma.19g194300
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G03840.1AT PEBP (phosphatidylethanolamine-binding protein) family protein JGI N/AIEA
GO:0009910GO-bp negative regulation of flower development EnsemblGenomesN/AIEA
GO:1903506GO-bp regulation of nucleic acid-templated transcription EnsemblGenomesN/AIEA
GO:0003712GO-mf transcription cofactor activity EnsemblGenomesN/AIEA
KOG3346 KOG Phosphatidylethanolamine binding protein JGI N/AIEA
PTHR11362Panther PHOSPHATIDYLETHANOLAMINE-BINDING PROTEIN JGI N/AIEA
PF01161PFAM Phosphatidylethanolamine-binding protein JGI N/AIEA

Proteins Associated with Glyma.19g194300
LocusGene SymbolProtein Name
TFL1b Terminal Flower 1 gene 2
DT1 protein TERMINAL FLOWER 1-like

Expression Patterns of Glyma.19g194300
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Related Legume Genes

View a gene family containing related genes from other legumes at LIS

Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.


View gene and ortholog information at GlycineMine

Gene information in GlycineMine developed by LIS.


Related Plant Genes

View a gene family containing related genes from other plant species at PhyloGenes

Gene families from PhyloGenes.


Paralogs of Glyma.19g194300
ParalogEvidenceComments
Glyma.03g194700 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.35.

Gene model name correspondences to Glyma.19g194300 Gene Call Version Wm82.a2.v1
Corresponding NameAnnotation VersionEvidenceComments
Glyma19g37890 Wm82.a1.v1.1IGC As supplied by JGI


Coding sequences of Glyma.19g194300
>Glyma.19g194300.1 sequence-type=CDS polypeptide=Glyma.19g194300.1.p locus=Glyma.19g194300 ID=Glyma.19g194300.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
ATGGCAAAAATGCCTTTAGAGCCTCTAATAGTGGGGAGAGTCATAGGAGAAGTTCTTGATTCTTTCACCACAAGCACAAAAATGACTGTGAGTTACAACAAGAAGCAAGTTTACAATGGCCATGAGCTCTTCCCTTCCACTGTCAACACCAAGCCCAAGGTTGAGATTGAGGGTGGTGATATGAGGTCCTTCTTTACACTGATCATGACTGACCCTGATGTTCCTGGCCCTAGTGACCCTTATCTGAGAGAGCACTTGCACTGGATAGTGACAGATATTCCAGGCACAACAGATGCCACATTTGGGAAAGAGTTGGTGAGCTATGAGGTCCCAAAGCCTAATATTGGAATCCATAGGTTTGTGTTTGTCCTGTTCAAGCAAAAGCGTAGACAGTGTGTTACTCCACCCACTTCAAGGGACCACTTCAACACACGCAAATTCGCAGCAGAGAACGACCTTGGCCTCCCTGTGGCTGCTGTCTACTTCAATGCACAGAGGGAAACGGCTGCAAGAAGACGCTAG
Predicted protein sequences of Glyma.19g194300
>Glyma.19g194300.1.p sequence-type=predicted peptide transcript=Glyma.19g194300.1 locus=Glyma.19g194300 ID=Glyma.19g194300.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
MAKMPLEPLIVGRVIGEVLDSFTTSTKMTVSYNKKQVYNGHELFPSTVNTKPKVEIEGGDMRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDATFGKELVSYEVPKPNIGIHRFVFVLFKQKRRQCVTPPTSRDHFNTRKFAAENDLGLPVAAVYFNAQRETAARRR*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo