SoyBase Follow us on Twitter @SoyBaseDatabase
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma.13g080200

Feature Type:gene_model
Chromosome:Gm13
Start:18671747
stop:18673041
Source:JGI
Version:Wm82.a2.v1
High confidence:yes



A previous version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G07850.1AT Pectin lyase-like superfamily protein JGI N/AIEA
GO:0005975GO-bp carbohydrate metabolic process EnsemblGenomesN/AIEA
GO:0005975GO-bp carbohydrate metabolic process JGI N/AIEA
GO:0008152GO-bp metabolic process EnsemblGenomesN/AIEA
GO:0004650GO-mf polygalacturonase activity EnsemblGenomesN/AIEA
GO:0004650GO-mf polygalacturonase activity JGI N/AIEA
GO:0016787GO-mf hydrolase activity EnsemblGenomesN/AIEA
GO:0016798GO-mf hydrolase activity, acting on glycosyl bonds EnsemblGenomesN/AIEA
PF00295PFAM Glycosyl hydrolases family 28 JGI N/AIEA
PWY-1081SoyCyc9 homogalacturonan degradation Plant Metabolic Network ISS
GN7V-44436SoyCyc9-rxn polygalacturonase Plant Metabolic Network ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma.13g080200 not represented in the dataset

Glyma.13g080200 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE


View a gene family containing related genes from other legumes at LIS

Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.


View gene and ortholog information at GlycineMine

Gene information in GlycineMine developed by LIS.



View a gene family containing related genes from other plant species at PhyloGenes

Gene families from PhyloGenes.


ParalogEvidenceComments
Glyma.14g149200 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.35.


>Glyma.13g080200.1 sequence-type=CDS polypeptide=Glyma.13g080200.1.p locus=Glyma.13g080200 ID=Glyma.13g080200.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
ATGGCTTGGAAACAAAATAATTATGCAACAAACAATAATTGCAAGAAGCTCGCCATGATAAATATAATAAATTCACTTGCATATAGTCCTAATACTAATGGAAGTCACATTGAAAAATCAACTCAAGTGAAGATTACTAAAATTGACACCGACAATGATTACATATCTCTAGGTGATGGAAGCAAAGAAGTCATTATCCTAAATGTAACATGTGGACTTGAACATAGTATTAGTTTTGTAGAAGATCTCAATGTCAAGAATTGTACACTAAGAAACACAAATAATGGTCTAAGGATCAAAACTTGGCCTGGTACTCCAATAAATTCTCTTGCATTTGATTTGCATTTTGAAGATACCAAAATGATTAATGTCATTAACCTTATCATTATAGATCAAGAGAACTTCTATCACTCGAGAAGGAGTACTCTTGTTTGTAGGAGTGATGTTCCTTTTGAAATTGTGGATCTAAACGACATAGATATAAGATTCAATGGAACTACTTTAGCAACTGGAAAATATGCAAATATCAAGTCAAATTTTGGAAGGAAAGCACCAATTTGTGCAACTTAG

>Glyma.13g080200.1.p sequence-type=predicted peptide transcript=Glyma.13g080200.1 locus=Glyma.13g080200 ID=Glyma.13g080200.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
MAWKQNNYATNNNCKKLAMINIINSLAYSPNTNGSHIEKSTQVKITKIDTDNDYISLGDGSKEVIILNVTCGLEHSISFVEDLNVKNCTLRNTNNGLRIKTWPGTPINSLAFDLHFEDTKMINVINLIIIDQENFYHSRRSTLVCRSDVPFEIVDLNDIDIRFNGTTLATGKYANIKSNFGRKAPICAT*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo