SoyBase Follow us on Twitter @SoyBaseDatabase
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma.08g363200

Feature Type:gene_model
Chromosome:Gm08
Start:47472881
stop:47473362
Source:JGI
Version:Wm82.a2.v1
High confidence:yes



A previous version of this gene model can be found here:

Annotations for Glyma.08g363200
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G62040.1AT PEBP (phosphatidylethanolamine-binding protein) family protein JGI N/AIEA
GO:0009909GO-bp regulation of flower development EnsemblGenomesN/AIEA
GO:0048573GO-bp photoperiodism, flowering EnsemblGenomesN/AIEA
GO:0008429GO-mf phosphatidylethanolamine binding EnsemblGenomesN/AIEA
PTHR11362Panther PHOSPHATIDYLETHANOLAMINE-BINDING PROTEIN JGI N/AIEA
PF01161PFAM Phosphatidylethanolamine-binding protein JGI N/AIEA

Proteins Associated with Glyma.08g363200
LocusGene SymbolProtein Name
FT6 Flowering locus T gene 6
FTL7 Flowering locus T-like gene 7

Expression Patterns of Glyma.08g363200
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Related Legume Genes

View a gene family containing related genes from other legumes at LIS

Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.


View gene and ortholog information at GlycineMine

Gene information in GlycineMine developed by LIS.


Related Plant Genes

View a gene family containing related genes from other plant species at PhyloGenes

Gene families from PhyloGenes.


Gene model name correspondences to Glyma.08g363200 Gene Call Version Wm82.a2.v1
Corresponding NameAnnotation VersionEvidenceComments
Glyma08g47823 Wm82.a1.v1.1IGC As supplied by JGI


Coding sequences of Glyma.08g363200
>Glyma.08g363200.1 sequence-type=CDS polypeptide=Glyma.08g363200.1.p locus=Glyma.08g363200 ID=Glyma.08g363200.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
ATGGCTATTACAACGAACCCTCTTGTTGTTGGACGTGTAATAGGAGATGTTCTGGAGCCATTTGCAAGTTCTATCCCTTTGAGAGTTGTTTACAACAATAACAAAGAAGTCATCAACAGTGGAGAGCTCAAACCCTCCCAAATAATCAACCCTCCACGAGTTGAGGTTGGTGGTGATGACCTCAGGACCCTCTACACTCTGGTCATGGTGGACCCTGATGCACCCAGCCCAAGTGACCCAAATATGAGGGAATATCTGCACTGGTAA
Predicted protein sequences of Glyma.08g363200
>Glyma.08g363200.1.p sequence-type=predicted peptide transcript=Glyma.08g363200.1 locus=Glyma.08g363200 ID=Glyma.08g363200.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
MAITTNPLVVGRVIGDVLEPFASSIPLRVVYNNNKEVINSGELKPSQIINPPRVEVGGDDLRTLYTLVMVDPDAPSPSDPNMREYLHW*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo