Report for Sequence Feature Glyma.08g341400
Feature Type: gene_model
Chromosome: Gm08
Start: 45728546
stop: 45729738
Source: JGI
Version: Wm82.a2.v1
High confidence: yes
A previous version of this gene model can be found here:
Annotations for Glyma.08g341400
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT1G17860.1 AT
Kunitz family trypsin and protease inhibitor protein
JGI N/A IEA
GO:0010951 GO-bp
negative regulation of endopeptidase activity
EnsemblGenomes N/A IEA
GO:0004866 GO-mf
endopeptidase inhibitor activity
EnsemblGenomes N/A IEA
GO:0004866 GO-mf
endopeptidase inhibitor activity
JGI N/A IEA
PF00197 PFAM
Trypsin and protease inhibitor
JGI N/A IEA
Proteins Associated with Glyma.08g341400
Locus Gene Symbol Protein Name
KTI2 Kunitz trypsin inhibitor gene 2
KTI-S Kunitz trypsin inhibitor S gene
KTI-1 kunitz trypsin inhibitor
Expression Patterns of Glyma.08g341400
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Related Legume Genes
Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS .
Gene information in GlycineMine developed by LIS .
Related Plant Genes
Gene families from PhyloGenes .
Gene model name correspondences to Glyma.08g341400 Gene Call Version Wm82.a2.v1
Corresponding Name Annotation Version Evidence Comments
Glyma08g45520 Wm82.a1.v1.1 IGC As supplied by JGI
Coding sequences of Glyma.08g341400
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma.08g341400.1 sequence-type=CDS polypeptide=Glyma.08g341400.1.p locus=Glyma.08g341400 ID=Glyma.08g341400.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
ATGAAGAGTACTACCTCTTTGGCTCTCTTTCTACTTTGTGCCCTAACTTCATCATATCAGCCTTCAGCCACCGCTGATATTGTATTCGACACCGAAGGCAATCCTATTCGAAACGGCGGCACATACTATGTGTTGCCAGTTATAAGAGGAAAGGGCGGCGGAATAGAATTTGCCAAAACCGAAACAGAAACATGCCCTCTCACTGTTGTGCAATCTCCCTTTGAGGTCTCAAAGGGTCTACCACTGATAATTTCATCCCCATTTAAAATCCTTGACATCACCGAAGGACTTATTTTGAGCCTCAGTTTCACTTATGTACCCCCCTGTGCCTCAACTCCTTCTCGGTGGACCGTTATTCTCAAGGGTCTGCCAGAAGAACTCCATGTCAAACTCACTGGCTACAAAAACACAATAGATGGTTGGTTTAGGATTCAAAGAGCTTCCTCTGAATCCAACTACTATAAGTTGGTGTTTTGTACATCTAATGATGATAGTTCGTGTGGGGATATTGTGGCTCCCATCGATCGTGAAGGAAACAGGCCTTTGATTGTGACTCATGATCAGAATCATCCATTGTTGGTTCAGTTTCAGAAAGTTGAAGCTTATGAATCATCAACTGCATGA
Predicted protein sequences of Glyma.08g341400
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma.08g341400.1.p sequence-type=predicted peptide transcript=Glyma.08g341400.1 locus=Glyma.08g341400 ID=Glyma.08g341400.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
MKSTTSLALFLLCALTSSYQPSATADIVFDTEGNPIRNGGTYYVLPVIRGKGGGIEFAKTETETCPLTVVQSPFEVSKGLPLIISSPFKILDITEGLILSLSFTYVPPCASTPSRWTVILKGLPEELHVKLTGYKNTIDGWFRIQRASSESNYYKLVFCTSNDDSSCGDIVAPIDREGNRPLIVTHDQNHPLLVQFQKVEAYESSTA*