SoyBase Follow us on Twitter @SoyBaseDatabase
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma.07G190900

Feature Type:gene_model
Chromosome:Gm07
Start:35851907
stop:35853732
Source:JGI
Version:Wm82.a2.v1
High confidence:yes



A previous version of this gene model can be found here:

Annotations for Glyma.07G190900
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G21540.3AT sphingosine kinase 1 JGI N/AIEA
GO:0007205GO-bp protein kinase C-activating G-protein coupled receptor signaling pathway JGI N/AIEA
GO:0008152GO-bp metabolic process EnsemblGenomesN/AIEA
GO:0016310GO-bp phosphorylation EnsemblGenomesN/AIEA
GO:0003951GO-mf NAD+ kinase activity EnsemblGenomesN/AIEA
GO:0004143GO-mf diacylglycerol kinase activity JGI N/AIEA
GO:0016301GO-mf kinase activity EnsemblGenomesN/AIEA
PTHR12358Panther SPHINGOSINE KINASE JGI N/AIEA
PTHR12358:SF10Panther JGI N/AIEA
PF00781PFAM Diacylglycerol kinase catalytic domain JGI N/AIEA
PWY-5129SoyCyc9 sphingolipid biosynthesis (plants) Plant Metabolic Network ISS
PWY-6483SoyCyc9 ceramide degradation Plant Metabolic Network ISS
GN7V-53808SoyCyc9-rxn Enzyme name not determined Plant Metabolic Network ISS

Expression Patterns of Glyma.07G190900
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma.07G190900 not represented in the dataset
Glyma.07G190900 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Related Legume Genes

View a gene family containing related genes from other legumes at LIS

Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.


View gene and ortholog information at GlycineMine

Gene information in GlycineMine developed by LIS.


Related Plant Genes

View a gene family containing related genes from other plant species at PhyloGenes

Gene families from PhyloGenes.


Paralogs of Glyma.07G190900
ParalogEvidenceComments
Glyma.08g058400 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.35.


Coding sequences of Glyma.07G190900
>Glyma.07g190900.1 sequence-type=CDS polypeptide=Glyma.07g190900.1.p locus=Glyma.07g190900 ID=Glyma.07g190900.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
ATGAGGCCCGGAAGAATAGAAAATGAAAATAGAAGCGATTCTCTAGAAACCAAACATCAGCTCCACGCAAAGCAAGTTGTTCAGTCACTTGATTTTTCAAAGTACGATGGGATTGTTTGTGTTAGTGGAGATGGGATCTTGGTAGAGTGGGTTGTAAATGGACTGCTTCAGAGCCAGGACTGGGACACTGCAATAAAGATGCCCCTTGGAGTAGTTCCTGCAGGTACGGGAAATGGCATGGCAAAATCTCTTCTTGATTCAGTTGGTCATCCTTGTACAGTACCCAATGCTGTTCTTGCCATCATACGAGGCCGTAATCGAAAACTTGGTGTGGCCATCATTACACAAGGAGAATTCAGATTTTTCAGTGGTCTGGTTGCTGATATTGATATTGAGTCTGAAAAGTATATATAA
Predicted protein sequences of Glyma.07G190900
>Glyma.07g190900.1.p sequence-type=predicted peptide transcript=Glyma.07g190900.1 locus=Glyma.07g190900 ID=Glyma.07g190900.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
MRPGRIENENRSDSLETKHQLHAKQVVQSLDFSKYDGIVCVSGDGILVEWVVNGLLQSQDWDTAIKMPLGVVPAGTGNGMAKSLLDSVGHPCTVPNAVLAIIRGRNRKLGVAIITQGEFRFFSGLVADIDIESEKYI*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo