SoyBase Follow us on Twitter @SoyBaseDatabase
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma.03g064700

Feature Type:gene_model
Chromosome:Gm03
Start:10673397
stop:10675085
Source:JGI
Version:Wm82.a2.v1
High confidence:yes



A previous version of this gene model can be found here:

Annotations for Glyma.03g064700
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G09920.1AT phosphatidyl inositol monophosphate 5 kinase JGI N/AIEA
GO:0046488GO-bp phosphatidylinositol metabolic process EnsemblGenomesN/AIEA
GO:0046488GO-bp phosphatidylinositol metabolic process JGI N/AIEA
GO:0046854GO-bp phosphatidylinositol phosphorylation EnsemblGenomesN/AIEA
GO:0016307GO-mf phosphatidylinositol phosphate kinase activity EnsemblGenomesN/AIEA
GO:0016307GO-mf phosphatidylinositol phosphate kinase activity JGI N/AIEA
PF01504PFAM Phosphatidylinositol-4-phosphate 5-Kinase JGI N/AIEA
PWY-6351SoyCyc9 D-myo-inositol (1,4,5)-trisphosphate biosynthesis Plant Metabolic Network ISS
PWY-6352SoyCyc9 3-phosphoinositide biosynthesis Plant Metabolic Network ISS
GN7V-64669SoyCyc9-rxn 1-phosphatidylinositol-4-phosphate 5-kinase Plant Metabolic Network ISS

Expression Patterns of Glyma.03g064700
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Related Legume Genes

View a gene family containing related genes from other legumes at LIS

Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.


View gene and ortholog information at GlycineMine

Gene information in GlycineMine developed by LIS.


Related Plant Genes

View a gene family containing related genes from other plant species at PhyloGenes

Gene families from PhyloGenes.


Gene model name correspondences to Glyma.03g064700 Gene Call Version Wm82.a2.v1
Corresponding NameAnnotation VersionEvidenceComments
Glyma03g09450 Wm82.a1.v1.1IGC As supplied by JGI


Coding sequences of Glyma.03g064700
>Glyma.03g064700.1 sequence-type=CDS polypeptide=Glyma.03g064700.1.p locus=Glyma.03g064700 ID=Glyma.03g064700.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
ATGCTTATTATCTTTCAATTAAAATATGAATGTCTTAATTTCATTTTTGTATGCTCCAAAACACTTCAGTATACGTGTTGTATTTGCATTTGCTATTTTACAGGATATGAAGCGCCAAATTTAAGAAAAAATGGATGTAGGTATGTCTTTGCAGGTGCTATCTTCATGTACGAGAGGTCGCAAACATACAGTAGTTACTGCAGAGACCATCAAGTCCATAATGGTGGAAATTTGTTGGAAGCAATTGAGATTGACAGCAAGTTCTTGGAATTACAACAGATAATGGATTACAGCCTCCTTCTAGGTGTTCATTATCGAGCTCCCCAGCAGTTGCATCCATACAACCAAAGTAGAAATGCAGATGGATTGGCAATTCTTGCAGAGGAAGGTGGGTATCTGATTAGAAAGCTAATGATTTGTGATTTGCCTTTATATGGTAAGCCAAATGAAATAACTAAACCATATAGAATGATGCATAGTGGAAAATGA
Predicted protein sequences of Glyma.03g064700
>Glyma.03g064700.1.p sequence-type=predicted peptide transcript=Glyma.03g064700.1 locus=Glyma.03g064700 ID=Glyma.03g064700.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
MLIIFQLKYECLNFIFVCSKTLQYTCCICICYFTGYEAPNLRKNGCRYVFAGAIFMYERSQTYSSYCRDHQVHNGGNLLEAIEIDSKFLELQQIMDYSLLLGVHYRAPQQLHPYNQSRNADGLAILAEEGGYLIRKLMICDLPLYGKPNEITKPYRMMHSGK*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo