SoyBase Follow us on Twitter @SoyBaseDatabase
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma19g32990

Feature Type:gene_model
Chromosome:Gm19
Start:40666918
stop:40669847
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G09810AT Annotation by Michelle Graham. TAIR10: actin 7 | chr5:3052809-3054220 FORWARD LENGTH=377 SoyBaseE_val: 0ISS
GO:0006007GO-bp Annotation by Michelle Graham. GO Biological Process: glucose catabolic process SoyBaseN/AISS
GO:0006094GO-bp Annotation by Michelle Graham. GO Biological Process: gluconeogenesis SoyBaseN/AISS
GO:0007010GO-bp Annotation by Michelle Graham. GO Biological Process: cytoskeleton organization SoyBaseN/AISS
GO:0009416GO-bp Annotation by Michelle Graham. GO Biological Process: response to light stimulus SoyBaseN/AISS
GO:0009611GO-bp Annotation by Michelle Graham. GO Biological Process: response to wounding SoyBaseN/AISS
GO:0009733GO-bp Annotation by Michelle Graham. GO Biological Process: response to auxin stimulus SoyBaseN/AISS
GO:0009845GO-bp Annotation by Michelle Graham. GO Biological Process: seed germination SoyBaseN/AISS
GO:0010053GO-bp Annotation by Michelle Graham. GO Biological Process: root epidermal cell differentiation SoyBaseN/AISS
GO:0010498GO-bp Annotation by Michelle Graham. GO Biological Process: proteasomal protein catabolic process SoyBaseN/AISS
GO:0032880GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of protein localization SoyBaseN/AISS
GO:0048364GO-bp Annotation by Michelle Graham. GO Biological Process: root development SoyBaseN/AISS
GO:0048767GO-bp Annotation by Michelle Graham. GO Biological Process: root hair elongation SoyBaseN/AISS
GO:0051301GO-bp Annotation by Michelle Graham. GO Biological Process: cell division SoyBaseN/AISS
GO:0005618GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cell wall SoyBaseN/AISS
GO:0005730GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleolus SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0005856GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoskeleton SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0009506GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma SoyBaseN/AISS
GO:0009570GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast stroma SoyBaseN/AISS
GO:0009941GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast envelope SoyBaseN/AISS
GO:0005200GO-mf Annotation by Michelle Graham. GO Molecular Function: structural constituent of cytoskeleton SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
GO:0005524GO-mf Annotation by Michelle Graham. GO Molecular Function: ATP binding SoyBaseN/AISS
KOG0676 KOG Actin and related proteins JGI ISS
PTHR11937Panther ACTIN JGI ISS
PTHR11937:SF77Panther ACTIN JGI ISS
PF00022PFAM Actin JGI ISS
UniRef100_C6T7Y1UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=3 Tax=Papilionoideae RepID=C6T7Y1_SOYBN SoyBaseE_val: 0ISS
UniRef100_Q9M729UniRef Annotation by Michelle Graham. Most informative UniRef hit: Actin n=1 Tax=Vigna radiata var. radiata RepID=Q9M729_VIGRR SoyBaseE_val: 0ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma19g32990 not represented in the dataset

Glyma19g32990 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma03g30110 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.19g147900 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma19g32990.2   sequence type=transcript   gene model=Glyma19g32990   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
TCTTCCCTCTTTCATCCCCCCGATAAGAACAAGCACCCACCGTTTAACGCTAATTTTTGAGTGTTTTTGTTTTTTGCAGCAACAAACAAACATCTTTTACCTTAAACAACAATGGCCGATGCCGAGGATATTCAACCCCTCGTTTGCGATAATGGAACCGGAATGGTCAAGGCTGGTTTTGCTGGAGATGATGCACCGAGGGCTGTGTTCCCTAGCATTGTGGGGCGTCCACGTCACACTGGGGTGATGGTTGGGATGGGGCAGAAGGATGCGTATGTTGGGGACGAGGCTCAATCCAAGAGGGGTATTTTGACTCTCAAATACCCAATTGAGCATGGAATTGTGAGCAATTGGGACGACATGGAGAAGATCTGGCATCACACTTTCTACAACGAGCTTCGTGTGGCTCCTGAGGAACACCCTGTGCTTCTCACCGAGGCACCTCTTAATCCTAAGGCTAATCGTGAGAAAATGACTCAGATCATGTTTGAGACCTTCAACACCCCTGCTATGTATGTCGCTATCCAGGCCGTGCTTTCCCTTTATGCTAGTGGCCGTACAACTGGTATTGTTCTGGACTCTGGAGATGGTGTCAGTCACACGGTTCCTATCTACGAAGGTTATGCCCTCCCACATGCAATCCTGCGTTTGGACCTTGCAGGGCGTGATCTCACTGATGCCCTCATGAAAATCTTGACTGAGCGTGGTTACACTTTCACCACATCTGCGGAACGGGAAATTGTGAGGGACATGAAGGAGAAACTGGCCTACATTGCTCTGGATTATGAGCAGGAGTTGGAAACTGCCAAGACCAGTTCAGCTGTTGAAAAGAGCTATGAGCTACCTGATGGGCAGGTGATCACGATTGGCGCTGAACGATTCCGATGCCCTGAAGTTCTGTTCCAGCCATCCATGATTGGGATGGAATCTCCTGGTATCCATGAGACAACATATAACTCTATCATGAAGTGTGATGTCGACATTAGGAAGGATCTCTATGGTAACATTGTCTTGAGTGGTGGTTCCACAATGTTCCCTGGCATTGCTGATAGGATGAGCAAGGAGATTACAGCATTGGCACCAAGTAGCATGAAAATTAAGGTTGTAGCACCACCAGAGAGGAAGTACAGTGTCTGGATTGGAGGCTCCATCTTGGCTTCCCTCAGCACCTTCCAACAGATGTGGATTGCGAAGGCAGAGTATGATGAATCTGGACCATCAATCGTACACAGGAAATGCTTCTAAGTTATAATCATGGAGTGTGAAAGCTGGACCAGGGAAATTACTATTTATACAAATACTACAAAAATACCATCTAGTGGTTGAGGAACTTTCATTTCCTACTCTTTACCATCCTTTTATCTATCTTGTTTTTGTGTTTTCCTTTCTTTGGTATGTTGAGATAAGAGCATGAAGGCTAGCAAGATATGTAAGATTCTTTTTTTTTTCTCCCGTTCTGTTGTAGAAGAGATGTGAATTGTTACCTATTTGGTTTGGTTGAATTAACAAATTCTTTTCATGAAGTATTCTGATTAACATAGTGGTACGGTACGTGCTTGATTTATAATTCTCTGCAACGAAAA

>Glyma19g32990.1   sequence type=CDS   gene model=Glyma19g32990   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCCGATGCCGAGGATATTCAACCCCTCGTTTGCGATAATGGAACCGGAATGGTCAAGGCTGGTTTTGCTGGAGATGATGCACCGAGGGCTGTGTTCCCTAGCATTGTGGGGCGTCCACGTCACACTGGGGTGATGGTTGGGATGGGGCAGAAGGATGCGTATGTTGGGGACGAGGCTCAATCCAAGAGGGGTATTTTGACTCTCAAATACCCAATTGAGCATGGAATTGTGAGCAATTGGGACGACATGGAGAAGATCTGGCATCACACTTTCTACAACGAGCTTCGTGTGGCTCCTGAGGAACACCCTGTGCTTCTCACCGAGGCACCTCTTAATCCTAAGGCTAATCGTGAGAAAATGACTCAGATCATGTTTGAGACCTTCAACACCCCTGCTATGTATGTCGCTATCCAGGCCGTGCTTTCCCTTTATGCTAGTGGCCGTACAACTGGTATTGTTCTGGACTCTGGAGATGGTGTCAGTCACACGGTTCCTATCTACGAAGGTTATGCCCTCCCACATGCAATCCTGCGTTTGGACCTTGCAGGGCGTGATCTCACTGATGCCCTCATGAAAATCTTGACTGAGCGTGGTTACACTTTCACCACATCTGCGGAACGGGAAATTGTGAGGGACATGAAGGAGAAACTGGCCTACATTGCTCTGGATTATGAGCAGGAGTTGGAAACTGCCAAGACCAGTTCAGCTGTTGAAAAGAGCTATGAGCTACCTGATGGGCAGGTGATCACGATTGGCGCTGAACGATTCCGATGCCCTGAAGTTCTGTTCCAGCCATCCATGATTGGGATGGAATCTCCTGGTATCCATGAGACAACATATAACTCTATCATGAAGTGTGATGTCGACATTAGGAAGGATCTCTATGGTAACATTGTCTTGAGTGGTGGTTCCACAATGTTCCCTGGCATTGCTGATAGGATGAGCAAGGAGATTACAGCATTGGCACCAAGTAGCATGAAAATTAAGGTTGTAGCACCACCAGAGAGGAAGTACAGTGTCTGGATTGGAGGCTCCATCTTGGCTTCCCTCAGCACCTTCCAACAGATGTGGATTGCGAAGGCAGAGTATGATGAATCTGGACCATCAATCGTACACAGGAAATGCTTCTAA

>Glyma19g32990.2   sequence type=CDS   gene model=Glyma19g32990   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCCGATGCCGAGGATATTCAACCCCTCGTTTGCGATAATGGAACCGGAATGGTCAAGGCTGGTTTTGCTGGAGATGATGCACCGAGGGCTGTGTTCCCTAGCATTGTGGGGCGTCCACGTCACACTGGGGTGATGGTTGGGATGGGGCAGAAGGATGCGTATGTTGGGGACGAGGCTCAATCCAAGAGGGGTATTTTGACTCTCAAATACCCAATTGAGCATGGAATTGTGAGCAATTGGGACGACATGGAGAAGATCTGGCATCACACTTTCTACAACGAGCTTCGTGTGGCTCCTGAGGAACACCCTGTGCTTCTCACCGAGGCACCTCTTAATCCTAAGGCTAATCGTGAGAAAATGACTCAGATCATGTTTGAGACCTTCAACACCCCTGCTATGTATGTCGCTATCCAGGCCGTGCTTTCCCTTTATGCTAGTGGCCGTACAACTGGTATTGTTCTGGACTCTGGAGATGGTGTCAGTCACACGGTTCCTATCTACGAAGGTTATGCCCTCCCACATGCAATCCTGCGTTTGGACCTTGCAGGGCGTGATCTCACTGATGCCCTCATGAAAATCTTGACTGAGCGTGGTTACACTTTCACCACATCTGCGGAACGGGAAATTGTGAGGGACATGAAGGAGAAACTGGCCTACATTGCTCTGGATTATGAGCAGGAGTTGGAAACTGCCAAGACCAGTTCAGCTGTTGAAAAGAGCTATGAGCTACCTGATGGGCAGGTGATCACGATTGGCGCTGAACGATTCCGATGCCCTGAAGTTCTGTTCCAGCCATCCATGATTGGGATGGAATCTCCTGGTATCCATGAGACAACATATAACTCTATCATGAAGTGTGATGTCGACATTAGGAAGGATCTCTATGGTAACATTGTCTTGAGTGGTGGTTCCACAATGTTCCCTGGCATTGCTGATAGGATGAGCAAGGAGATTACAGCATTGGCACCAAGTAGCATGAAAATTAAGGTTGTAGCACCACCAGAGAGGAAGTACAGTGTCTGGATTGGAGGCTCCATCTTGGCTTCCCTCAGCACCTTCCAACAGATGTGGATTGCGAAGGCAGAGTATGATGAATCTGGACCATCAATCGTACACAGGAAATGCTTCTAA

>Glyma19g32990.1   sequence type=predicted peptide   gene model=Glyma19g32990   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MADAEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYTFTTSAEREIVRDMKEKLAYIALDYEQELETAKTSSAVEKSYELPDGQVITIGAERFRCPEVLFQPSMIGMESPGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKCF*

>Glyma19g32990.2   sequence type=predicted peptide   gene model=Glyma19g32990   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MADAEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYTFTTSAEREIVRDMKEKLAYIALDYEQELETAKTSSAVEKSYELPDGQVITIGAERFRCPEVLFQPSMIGMESPGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKCF*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo