SoyBase Follow us on Twitter @SoyBaseDatabase
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma17g05270

Feature Type:gene_model
Chromosome:Gm17
Start:3623667
stop:3625594
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G44860AT Annotation by Michelle Graham. TAIR10: Ribosomal protein L24e family protein | chr2:18501034-18502128 REVERSE LENGTH=159 SoyBaseE_val: 3.00E-81ISS
GO:0001510GO-bp Annotation by Michelle Graham. GO Biological Process: RNA methylation SoyBaseN/AISS
GO:0006364GO-bp Annotation by Michelle Graham. GO Biological Process: rRNA processing SoyBaseN/AISS
GO:0006412GO-bp Annotation by Michelle Graham. GO Biological Process: translation SoyBaseN/AISS
GO:0042254GO-bp Annotation by Michelle Graham. GO Biological Process: ribosome biogenesis SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005730GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleolus SoyBaseN/AISS
GO:0005840GO-cc Annotation by Michelle Graham. GO Cellular Compartment: ribosome SoyBaseN/AISS
GO:0022625GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosolic large ribosomal subunit SoyBaseN/AISS
GO:0003735GO-mf Annotation by Michelle Graham. GO Molecular Function: structural constituent of ribosome SoyBaseN/AISS
KOG1723 KOG 60s ribosomal protein L30 isolog JGI ISS
PTHR10792Panther 60S RIBOSOMAL PROTEIN L24 JGI ISS
PTHR10792:SF3Panther gb def: Putative ribosomal protein L30 (Fragment) JGI ISS
PF01246PFAM Ribosomal protein L24e JGI ISS
UniRef100_B7FMU0UniRef Annotation by Michelle Graham. Most informative UniRef hit: Ribosome biogenesis protein rlp24 n=1 Tax=Medicago truncatula RepID=B7FMU0_MEDTR SoyBaseE_val: 4.00E-86ISS
UniRef100_I1MS60UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MS60_SOYBN SoyBaseE_val: 1.00E-120ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma17g05270 not represented in the dataset

Glyma17g05270 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma12g30680 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.13g318800 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma17g05270.1   sequence type=CDS   gene model=Glyma17g05270   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAGATTGGAGAAATGCTGGTTTTGCTCTTCAACCGTATACCCCGGACATGGAATCCAGTTTGTTCGTAATGATGCAAAGATTTTTCGGTTTTGTAGATCAAAATGCCACAAGAACTTTAAAATGAAGAGAAATCCTCGTAAGGTAAAGTGGACCAAGGCATATCGTCGAGTGCATGGAAAGGATATGACTCAGGACTCAACCTTTGAGTTTGAGAGAAAACGAAACAGGCCTGAAAGATATGACAGGAATCTTGCGGAGAATGTCCTGAAGGCCATTCCTAAGATTGATAAAATCAGAGTCACCAGGGAGGAGAGACACCATAAGAACAGGATGAAAGGAAAAAAGGAAAAGCTGCTGAAGGAGGCAGTGAAGGAGTTGGAGCAGGGCATCAGTTTGGTCAAAGCTCCTTCTGTGCTTCAACAGGATCCATCTCTCACATTACCAAAGATCAAAGTCAAGGTTTCCCAACAGCAATCAGAGGAGAATCATGCCATGGAAGAGTAA

>Glyma17g05270.1   sequence type=predicted peptide   gene model=Glyma17g05270   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MRLEKCWFCSSTVYPGHGIQFVRNDAKIFRFCRSKCHKNFKMKRNPRKVKWTKAYRRVHGKDMTQDSTFEFERKRNRPERYDRNLAENVLKAIPKIDKIRVTREERHHKNRMKGKKEKLLKEAVKELEQGISLVKAPSVLQQDPSLTLPKIKVKVSQQQSEENHAMEE*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo