SoyBase Follow us on Twitter @SoyBaseDatabase
Integrating Genetics and Genomics to Advance Soybean Research



Feature Type:
Chromosome:
Start:
stop:
Source:JGI
Version:Wm82.a1.v1.1



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G18250AT Annotation by Michelle Graham. TAIR10: 4-phosphopantetheine adenylyltransferase | chr2:7940025-7941499 FORWARD LENGTH=176 SoyBaseE_val: 6.00E-84ISS
GO:0006629GO-bp Annotation by Michelle Graham. GO Biological Process: lipid metabolic process SoyBaseN/AISS
GO:0006970GO-bp Annotation by Michelle Graham. GO Biological Process: response to osmotic stress SoyBaseN/AISS
GO:0009058GO-bp Annotation by Michelle Graham. GO Biological Process: biosynthetic process SoyBaseN/AISS
GO:0009651GO-bp Annotation by Michelle Graham. GO Biological Process: response to salt stress SoyBaseN/AISS
GO:0015937GO-bp Annotation by Michelle Graham. GO Biological Process: coenzyme A biosynthetic process SoyBaseN/AISS
GO:0019344GO-bp Annotation by Michelle Graham. GO Biological Process: cysteine biosynthetic process SoyBaseN/AISS
GO:0019915GO-bp Annotation by Michelle Graham. GO Biological Process: lipid storage SoyBaseN/AISS
GO:0040007GO-bp Annotation by Michelle Graham. GO Biological Process: growth SoyBaseN/AISS
GO:0080020GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of coenzyme A biosynthetic process SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0003824GO-mf Annotation by Michelle Graham. GO Molecular Function: catalytic activity SoyBaseN/AISS
GO:0004140GO-mf Annotation by Michelle Graham. GO Molecular Function: dephospho-CoA kinase activity SoyBaseN/AISS
GO:0004595GO-mf Annotation by Michelle Graham. GO Molecular Function: pantetheine-phosphate adenylyltransferase activity SoyBaseN/AISS
GO:0005524GO-mf Annotation by Michelle Graham. GO Molecular Function: ATP binding SoyBaseN/AISS
GO:0016779GO-mf Annotation by Michelle Graham. GO Molecular Function: nucleotidyltransferase activity SoyBaseN/AISS
PTHR24702Panther FAMILY NOT NAMED JGI ISS
PF01467PFAM Cytidylyltransferase JGI ISS
UniRef100_G7KEY2UniRef Annotation by Michelle Graham. Most informative UniRef hit: Phosphopantetheine adenylyltransferase n=1 Tax=Medicago truncatula RepID=G7KEY2_MEDTR SoyBaseE_val: 2.00E-104ISS
UniRef100_I1J8T5UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1J8T5_SOYBN SoyBaseE_val: 9.00E-128ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma01g37870.2   sequence type=transcript   gene model=Glyma01g37870   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
AGATAATGCCAAAGCTTGAAACTTGTGTGCAGGCTTCAGCGGAGTTGGCAAGGCGCCGGATTGTAATTGGAGTTTGCGATGGACCTATGCTGGCAAAAAAACAGTTTGCTGAACTGATACAGCCCATTGAGGAAAGGATAAATAATGTCAAAACTTTCATAAAGTCTATCAAGCCGGAGTTGGAAGTGCAAGCTGTGCCAATCACAGATCCATTTGGCCCTTCCATTACAGATGAGAACTTGGAGGCTGTGATTGTAAGCAAAGAGACATTACCGGGAGGATTGGCTATAAACAGAAGAAGAGCTGAAAGAGATCTTTCACAGTTGAAGATTGAAGTTGTAGATTTGGTCTCTGGAGAATCAGGTGAAATTAAGCTGAGTTCATCAATGCTACGGAAGATTGAGGCTGAAAGGGCTAAACAACAAAACACGATACCGCAGACTTAGTTACAGACAATTTGTTTAACTTTTTTCTTTCAAAATATTTCTTCAAAGATGAGTTTAAGGTGTCCATTAAAGCAACTGACATGTGAGTGCATGTTACCATGTTATGACATTGTTTAAGTTTAAAAGGTGGAAGTCACATTCTTTAGGAAAAATATTGTAAAGATGTATCGTTTTTTTTTCAACGCACCAAACAAAAAACATTATTAGTTTGTTTAGAGGAATGTGTTGTATTTATATTTATATTTTCTCTAATAGAAATAAGTATTTTATTCTAAACA

>Glyma01g37870.3   sequence type=transcript   gene model=Glyma01g37870   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
CTAACGAACCATTGGTTCAATATATATAACAACGAATCCGATCCTCTTTTCATCTCACACCTACTGCCACCAGTGAAAGTCATTCCTGCACATCGAATGGCGGTTCACGGTGACGATGACACCATGGTGATGGTGGTTCCCAAACTCTCTCCGCCCAACACCTACGAAGCCGTCGTCAATGGTGGCACCTTCGACCGATTGCACGACGGCCACCGCCTCTTCCTCACCGCTTCAGCGGAGTTGGCAAGGCGCCGGATTGTAATTGGAGTTTGCGATGGACCTATGCTGGCAAAAAAACAGTTTGCTGAACTGATACAGCCCATTGAGGAAAGGATAAATAATGTCAAAACTTTCATAAAGTCTATCAAGCCGGAGTTGGAAGTGCAAGCTGTGCCAATCACAGATCCATTTGGCCCTTCCATTACAGATGAGAACTTGGAGGCTGTGATTGTAAGCAAAGAGACATTACCGGGAGGATTGGCTATAAACAGAAGAAGAGCTGAAAGAGATCTTTCACAGTTGAAGGTCTCAATTTATTGTTTGTGTAGTTTGGTTATAATTTCTGACATAAAAGTTAAGAAAATATTATCAAAATATTTTGTCAGATATTAGAAATTATTTTCTTGGATCTTATGCAGATTGAAGTTGTAGATTTGGTCTCTGGAGAATCAGGTGAAATTAAGCTGAGTTCATCAATGCTACGGAAGATTGAGGCTGAAAGGGCTAAACAACAAAACACGATACCGCAGACTTAGTTACAGACAATTTGTTTAACTTTTTTCTTTCAAAATATTTCTTCAAAGATGAGTTTAAGGTGTCCATTAAAGCAACTGACATGTGAGTGCATGTTACCATGTTATGACATTGTTTAAGTTTAAAAGGTGGAAGTCACATTCTTTAGGAAAAATATTGTAAAGATGTATCGTTTTTTTTTCAACGCACCAAACAAAAAACATTATTAGTTTGTTTAGAGGAATGTGTTGTATTTATATTTATATTTTCTCTAATAGAAATAAGTATTTTATTCTAAACA

>Glyma01g37870.1   sequence type=CDS   gene model=Glyma01g37870   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCGGTTCACGGTGACGATGACACCATGGTGATGGTGGTTCCCAAACTCTCTCCGCCCAACACCTACGAAGCCGTCGTCAATGGTGGCACCTTCGACCGATTGCACGACGGCCACCGCCTCTTCCTCACCGCTTCAGCGGAGTTGGCAAGGCGCCGGATTGTAATTGGAGTTTGCGATGGACCTATGCTGGCAAAAAAACAGTTTGCTGAACTGATACAGCCCATTGAGGAAAGGATAAATAATGTCAAAACTTTCATAAAGTCTATCAAGCCGGAGTTGGAAGTGCAAGCTGTGCCAATCACAGATCCATTTGGCCCTTCCATTACAGATGAGAACTTGGAGGCTGTGATTGTAAGCAAAGAGACATTACCGGGAGGATTGGCTATAAACAGAAGAAGAGCTGAAAGAGATCTTTCACAGTTGAAGATTGAAGTTGTAGATTTGGTCTCTGGAGAATCAGGTGAAATTAAGCTGAGTTCATCAATGCTACGGAAGATTGAGGCTGAAAGGGCTAAACAACAAAACACGATACCGCAGACTTAG

>Glyma01g37870.2   sequence type=CDS   gene model=Glyma01g37870   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCCAAAGCTTGAAACTTGTGTGCAGGCTTCAGCGGAGTTGGCAAGGCGCCGGATTGTAATTGGAGTTTGCGATGGACCTATGCTGGCAAAAAAACAGTTTGCTGAACTGATACAGCCCATTGAGGAAAGGATAAATAATGTCAAAACTTTCATAAAGTCTATCAAGCCGGAGTTGGAAGTGCAAGCTGTGCCAATCACAGATCCATTTGGCCCTTCCATTACAGATGAGAACTTGGAGGCTGTGATTGTAAGCAAAGAGACATTACCGGGAGGATTGGCTATAAACAGAAGAAGAGCTGAAAGAGATCTTTCACAGTTGAAGATTGAAGTTGTAGATTTGGTCTCTGGAGAATCAGGTGAAATTAAGCTGAGTTCATCAATGCTACGGAAGATTGAGGCTGAAAGGGCTAAACAACAAAACACGATACCGCAGACTTAG

>Glyma01g37870.3   sequence type=CDS   gene model=Glyma01g37870   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCGGTTCACGGTGACGATGACACCATGGTGATGGTGGTTCCCAAACTCTCTCCGCCCAACACCTACGAAGCCGTCGTCAATGGTGGCACCTTCGACCGATTGCACGACGGCCACCGCCTCTTCCTCACCGCTTCAGCGGAGTTGGCAAGGCGCCGGATTGTAATTGGAGTTTGCGATGGACCTATGCTGGCAAAAAAACAGTTTGCTGAACTGATACAGCCCATTGAGGAAAGGATAAATAATGTCAAAACTTTCATAAAGTCTATCAAGCCGGAGTTGGAAGTGCAAGCTGTGCCAATCACAGATCCATTTGGCCCTTCCATTACAGATGAGAACTTGGAGGCTGTGATTGTAAGCAAAGAGACATTACCGGGAGGATTGGCTATAAACAGAAGAAGAGCTGAAAGAGATCTTTCACAGTTGAAGGTCTCAATTTATTGTTTGTGTAGTTTGGTTATAATTTCTGACATAAAAGTTAAGAAAATATTATCAAAATATTTTGTCAGATATTAG

>Glyma01g37870.1   sequence type=predicted peptide   gene model=Glyma01g37870   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAVHGDDDTMVMVVPKLSPPNTYEAVVNGGTFDRLHDGHRLFLTASAELARRRIVIGVCDGPMLAKKQFAELIQPIEERINNVKTFIKSIKPELEVQAVPITDPFGPSITDENLEAVIVSKETLPGGLAINRRRAERDLSQLKIEVVDLVSGESGEIKLSSSMLRKIEAERAKQQNTIPQT*

>Glyma01g37870.2   sequence type=predicted peptide   gene model=Glyma01g37870   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MPKLETCVQASAELARRRIVIGVCDGPMLAKKQFAELIQPIEERINNVKTFIKSIKPELEVQAVPITDPFGPSITDENLEAVIVSKETLPGGLAINRRRAERDLSQLKIEVVDLVSGESGEIKLSSSMLRKIEAERAKQQNTIPQT*

>Glyma01g37870.3   sequence type=predicted peptide   gene model=Glyma01g37870   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAVHGDDDTMVMVVPKLSPPNTYEAVVNGGTFDRLHDGHRLFLTASAELARRRIVIGVCDGPMLAKKQFAELIQPIEERINNVKTFIKSIKPELEVQAVPITDPFGPSITDENLEAVIVSKETLPGGLAINRRRAERDLSQLKVSIYCLCSLVIISDIKVKKILSKYFVRY*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo