SoyBase Follow us on Twitter @SoyBaseDatabase
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma01g37870

This Glyma 1.1 gene model is not represented in the 2nd genome assembly and is only shown in relation to the 1.0 assembly in GBrowse


Feature Type:gene_model
Chromosome:Gm01
Start:50146984
stop:50150059
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



This gene model is present only in the previous Wm82.a1 assembly, annotation version 1.1 set. .


Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G18250AT Annotation by Michelle Graham. TAIR10: 4-phosphopantetheine adenylyltransferase | chr2:7940025-7941499 FORWARD LENGTH=176 SoyBaseE_val: 6.00E-84ISS
GO:0080020GO Annotation by Michelle Graham. GO Biological Process: regulation of coenzyme A biosynthetic process SoyBaseISS
GO:0040007GO Annotation by Michelle Graham. GO Biological Process: growth SoyBaseISS
GO:0009058GO Annotation by Michelle Graham. GO Biological Process: biosynthetic process SoyBaseISS
GO:0009651GO Annotation by Michelle Graham. GO Biological Process: response to salt stress SoyBaseISS
GO:0015937GO Annotation by Michelle Graham. GO Biological Process: coenzyme A biosynthetic process SoyBaseISS
GO:0016779GO Annotation by Michelle Graham. GO Molecular Function: nucleotidyltransferase activity SoyBaseISS
GO:0019344GO Annotation by Michelle Graham. GO Biological Process: cysteine biosynthetic process SoyBaseISS
GO:0019915GO Annotation by Michelle Graham. GO Biological Process: lipid storage SoyBaseISS
GO:0006970GO Annotation by Michelle Graham. GO Biological Process: response to osmotic stress SoyBaseISS
GO:0006629GO Annotation by Michelle Graham. GO Biological Process: lipid metabolic process SoyBaseISS
GO:0005634GO Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseISS
GO:0005829GO Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseISS
GO:0003824GO Annotation by Michelle Graham. GO Molecular Function: catalytic activity SoyBaseISS
GO:0004140GO Annotation by Michelle Graham. GO Molecular Function: dephospho-CoA kinase activity SoyBaseISS
GO:0004595GO Annotation by Michelle Graham. GO Molecular Function: pantetheine-phosphate adenylyltransferase activity SoyBaseISS
GO:0005524GO Annotation by Michelle Graham. GO Molecular Function: ATP binding SoyBaseISS
PTHR24702Panther FAMILY NOT NAMED JGI ISS
PF01467PFAM Cytidylyltransferase JGI ISS
UniRef100_G7KEY2UniRef Annotation by Michelle Graham. Most informative UniRef hit: Phosphopantetheine adenylyltransferase n=1 Tax=Medicago truncatula RepID=G7KEY2_MEDTR SoyBaseE_val: 2.00E-104ISS
UniRef100_I1J8T5UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1J8T5_SOYBN SoyBaseE_val: 9.00E-128ISS


View a gene family containing related genes from other legumes at LIS

Gene families from Phytozom1e are displayed using the PhyloTree viewer developed by LIS.


Corresponding NameAnnotation VersionEvidenceComments

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183


Annotation data from JGI Version Wm82.a1.v1.1
FeatureFeature NameChromosomeStartStop
GENEGlyma01g37870 Gm015014698450150059
mRNAGlyma01g37870.1  5014698450150059
mRNAGlyma01g37870.2  5014728850150059
mRNAGlyma01g37870.3  5014698450150059

>Glyma01g37870.1   sequence type=primary transcript   gene model=Glyma01g37870   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
CTAACGAACCATTGGTTCAATATATATAACAACGAATCCGATCCTCTTTTCATCTCACACCTACTGCCACCAGTGAAAGTCATTCCTGCACATCGAATGGCGGTTCACGGTGACGATGACACCATGGTGATGGTGGTTCCCAAACTCTCTCCGCCCAACACCTACGAAGCCGTCGTCAATGGTGGCACCTTCGACCGATTGCACGACGGCCACCGCCTCTTCCTCACCGCTTCAGCGGAGTTGGCAAGGCGCCGGATTGTAATTGGAGTTTGCGATGGACCTATGCTGGCAAAAAAACAGTTTGCTGAACTGATACAGCCCATTGAGGAAAGGATAAATAATGTCAAAACTTTCATAAAGTCTATCAAGCCGGAGTTGGAAGTGCAAGCTGTGCCAATCACAGATCCATTTGGCCCTTCCATTACAGATGAGAACTTGGAGGCTGTGATTGTAAGCAAAGAGACATTACCGGGAGGATTGGCTATAAACAGAAGAAGAGCTGAAAGAGATCTTTCACAGTTGAAGATTGAAGTTGTAGATTTGGTCTCTGGAGAATCAGGTGAAATTAAGCTGAGTTCATCAATGCTACGGAAGATTGAGGCTGAAAGGGCTAAACAACAAAACACGATACCGCAGACTTAGTTACAGACAATTTGTTTAACTTTTTTCTTTCAAAATATTTCTTCAAAGATGAGTTTAAGGTGTCCATTAAAGCAACTGACATGTGAGTGCATGTTACCATGTTATGACATTGTTTAAGTTTAAAAGGTGGAAGTCACATTCTTTAGGAAAAATATTGTAAAGATGTATCGTTTTTTTTTCAACGCACCAAACAAAAAACATTATTAGTTTGTTTAGAGGAATGTGTTGTATTTATATTTATATTTTCTCTAATAGAAATAAGTATTTTATTCTAAACA

>Glyma01g37870.1   sequence type=CDS   gene model=Glyma01g37870   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCGGTTCACGGTGACGATGACACCATGGTGATGGTGGTTCCCAAACTCTCTCCGCCCAACACCTACGAAGCCGTCGTCAATGGTGGCACCTTCGACCGATTGCACGACGGCCACCGCCTCTTCCTCACCGCTTCAGCGGAGTTGGCAAGGCGCCGGATTGTAATTGGAGTTTGCGATGGACCTATGCTGGCAAAAAAACAGTTTGCTGAACTGATACAGCCCATTGAGGAAAGGATAAATAATGTCAAAACTTTCATAAAGTCTATCAAGCCGGAGTTGGAAGTGCAAGCTGTGCCAATCACAGATCCATTTGGCCCTTCCATTACAGATGAGAACTTGGAGGCTGTGATTGTAAGCAAAGAGACATTACCGGGAGGATTGGCTATAAACAGAAGAAGAGCTGAAAGAGATCTTTCACAGTTGAAGATTGAAGTTGTAGATTTGGTCTCTGGAGAATCAGGTGAAATTAAGCTGAGTTCATCAATGCTACGGAAGATTGAGGCTGAAAGGGCTAAACAACAAAACACGATACCGCAGACTTAG

>Glyma01g37870.2   sequence type=CDS   gene model=Glyma01g37870   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCCAAAGCTTGAAACTTGTGTGCAGGCTTCAGCGGAGTTGGCAAGGCGCCGGATTGTAATTGGAGTTTGCGATGGACCTATGCTGGCAAAAAAACAGTTTGCTGAACTGATACAGCCCATTGAGGAAAGGATAAATAATGTCAAAACTTTCATAAAGTCTATCAAGCCGGAGTTGGAAGTGCAAGCTGTGCCAATCACAGATCCATTTGGCCCTTCCATTACAGATGAGAACTTGGAGGCTGTGATTGTAAGCAAAGAGACATTACCGGGAGGATTGGCTATAAACAGAAGAAGAGCTGAAAGAGATCTTTCACAGTTGAAGATTGAAGTTGTAGATTTGGTCTCTGGAGAATCAGGTGAAATTAAGCTGAGTTCATCAATGCTACGGAAGATTGAGGCTGAAAGGGCTAAACAACAAAACACGATACCGCAGACTTAG

>Glyma01g37870.3   sequence type=CDS   gene model=Glyma01g37870   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCGGTTCACGGTGACGATGACACCATGGTGATGGTGGTTCCCAAACTCTCTCCGCCCAACACCTACGAAGCCGTCGTCAATGGTGGCACCTTCGACCGATTGCACGACGGCCACCGCCTCTTCCTCACCGCTTCAGCGGAGTTGGCAAGGCGCCGGATTGTAATTGGAGTTTGCGATGGACCTATGCTGGCAAAAAAACAGTTTGCTGAACTGATACAGCCCATTGAGGAAAGGATAAATAATGTCAAAACTTTCATAAAGTCTATCAAGCCGGAGTTGGAAGTGCAAGCTGTGCCAATCACAGATCCATTTGGCCCTTCCATTACAGATGAGAACTTGGAGGCTGTGATTGTAAGCAAAGAGACATTACCGGGAGGATTGGCTATAAACAGAAGAAGAGCTGAAAGAGATCTTTCACAGTTGAAGGTCTCAATTTATTGTTTGTGTAGTTTGGTTATAATTTCTGACATAAAAGTTAAGAAAATATTATCAAAATATTTTGTCAGATATTAG

>Glyma01g37870.1   sequence type=predicted peptide   gene model=Glyma01g37870   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAVHGDDDTMVMVVPKLSPPNTYEAVVNGGTFDRLHDGHRLFLTASAELARRRIVIGVCDGPMLAKKQFAELIQPIEERINNVKTFIKSIKPELEVQAVPITDPFGPSITDENLEAVIVSKETLPGGLAINRRRAERDLSQLKIEVVDLVSGESGEIKLSSSMLRKIEAERAKQQNTIPQT*

>Glyma01g37870.2   sequence type=predicted peptide   gene model=Glyma01g37870   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MPKLETCVQASAELARRRIVIGVCDGPMLAKKQFAELIQPIEERINNVKTFIKSIKPELEVQAVPITDPFGPSITDENLEAVIVSKETLPGGLAINRRRAERDLSQLKIEVVDLVSGESGEIKLSSSMLRKIEAERAKQQNTIPQT*

>Glyma01g37870.3   sequence type=predicted peptide   gene model=Glyma01g37870   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAVHGDDDTMVMVVPKLSPPNTYEAVVNGGTFDRLHDGHRLFLTASAELARRRIVIGVCDGPMLAKKQFAELIQPIEERINNVKTFIKSIKPELEVQAVPITDPFGPSITDENLEAVIVSKETLPGGLAINRRRAERDLSQLKVSIYCLCSLVIISDIKVKKILSKYFVRY*







USDA Logo
Iowa State University Logo