SoyBase Follow us on Twitter @SoyBaseDatabase
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma.19g127700

Feature Type:gene_model
Chromosome:Gm19
Start:38632803
stop:38635633
Source:JGI
Version:Wm82.a2.v1
High confidence:yes



A previous version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G12250.1AT beta-6 tubulin JGI N/AIEA
GO:0006184GO-bp GTP catabolic process JGI N/AIEA
GO:0007010GO-bp cytoskeleton organization EnsemblGenomesN/AIEA
GO:0007017GO-bp microtubule-based process EnsemblGenomesN/AIEA
GO:0051258GO-bp protein polymerization JGI N/AIEA
GO:0005737GO-cc cytoplasm EnsemblGenomesN/AIEA
GO:0005856GO-cc cytoskeleton EnsemblGenomesN/AIEA
GO:0005874GO-cc microtubule EnsemblGenomesN/AIEA
GO:0000166GO-mf nucleotide binding EnsemblGenomesN/AIEA
GO:0003924GO-mf GTPase activity EnsemblGenomesN/AIEA
GO:0003924GO-mf GTPase activity JGI N/AIEA
GO:0005200GO-mf structural constituent of cytoskeleton EnsemblGenomesN/AIEA
GO:0005525GO-mf GTP binding EnsemblGenomesN/AIEA
GO:0005525GO-mf GTP binding JGI N/AIEA
KOG1375 KOG Beta tubulin JGI N/AIEA
PTHR11588Panther TUBULIN JGI N/AIEA
PF00091PFAM Tubulin/FtsZ family, GTPase domain JGI N/AIEA
PF03953PFAM Tubulin C-terminal domain JGI N/AIEA
GN7V-65990SoyCyc9-rxn purine-nucleoside phosphorylase Plant Metabolic Network ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE


View a gene family containing related genes from other legumes at LIS

Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.


View gene and ortholog information at SoyMine

Gene information in SoyMine developed by LIS.



View a gene family containing related genes from other plant species at PhyloGenes

Gene families from PhyloGenes.


ParalogEvidenceComments
Glyma.03g124400 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.35.

Corresponding NameAnnotation VersionEvidenceComments
Glyma19g30770 Wm82.a1.v1.1IGC As supplied by JGI


>Glyma.19g127700.1 sequence-type=CDS polypeptide=Glyma.19g127700.1.p locus=Glyma.19g127700 ID=Glyma.19g127700.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
ATGAGGGAGATCCTTCACGTGCAGGGAGGGCAATGCGGGAACCAGATCGGTTCCAAGTTCTGGGAAGTGGTGTGCGACGAGCACGGCATAGATCCGACGGGGAAGTACGTCGGAAACTCAGATCTGCAACTCGAGCGCGTGAACGTCTACTACAATGAAGCCTCGTGCGGGCGCTTCGTGCCACGCGCGGTGCTGATGGACCTGGAGCCCGGAACCATGGACAGCGTGCGGACCGGGCCGTACGGGCAGATCTTCCGCCCCGACAACTTCGTGTTCGGGCAGTCCGGCGCCGGCAACAACTGGGCTAAGGGGCACTACACCGAGGGCGCCGAGCTCATCGACTCCGTCCTCGACGTCGTGCGTAAGGAGGCCGAGAACTGCGACTGCCTCCAGGGGTTCCAGGTCTGCCACTCGCTCGGCGGCGGAACGGGCTCCGGGATGGGGACGCTTCTTATTTCCAAGATCAGAGAGGAGTATCCTGACAGGATGATGCTTACTTTCTCCGTTTTTCCTTCGCCCAAGGTCTCCGACACTGTTGTTGAGCCTTATAACGCTACTCTCTCTGTTCACCAGTTGGTGGAGAATGCTGATGAGTGTATGGTGCTGGATAATGAGGCGCTCTACGATATCTGCTTCAGGACTCTCAAGTTGACCACTCCTAGCTTTGGTGACTTGAATCACTTGATCTCCGCAACCATGAGTGGTGTTACATGCTGTCTTCGTTTCCCTGGTCAACTCAACTCTGATCTGAGGAAACTGGCCGTGAATCTCATCCCTTTCCCTCGTCTGCACTTCTTCATGGTTGGATTTGCGCCTCTCACCTCTCGTGGCTCTCAGCAGTACCGTGCATTGACAGTTCCAGAGCTGACACAGCAAATGTGGGATGCCAAGAATATGATGTGTGCCGCTGATCCCAGGCACGGGCGTTACCTCACGGCATCAGCCATGTTCCGTGGCAAGATGAGCACGAAGGAGGTGGATGAGCAGATGATAAACGTGCAGAACAAAAACTCTTCGTACTTTGTCGAGTGGATTCCCAACAATGTCAAGTCGAGTGTGTGTGACATTGCTCCTAGAGGGCTCTCCATGGCGTCCACATTCATTGGAAACTCGACCTCGATTCAGGAGATGTTCAGGAGGGTGAGCGAGCAGTTCACGGCCATGTTTAGGAGGAAGGCTTTCTTGCATTGGTACACTGGTGAAGGCATGGACGAGATGGAGTTCACGGAGGCAGAGAGCAACATGAATGACCTTGTGTCTGAGTACCAGCAGTACCAGGACGCCACTGCTGAGGACGAAGGGGAGTACGAGGATGAGGAGGAAGAGGATGGTGAAGCAGACGACCATATGTGA

>Glyma.19g127700.1.p sequence-type=predicted peptide transcript=Glyma.19g127700.1 locus=Glyma.19g127700 ID=Glyma.19g127700.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGKYVGNSDLQLERVNVYYNEASCGRFVPRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLTFSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLTTPSFGDLNHLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTVPELTQQMWDAKNMMCAADPRHGRYLTASAMFRGKMSTKEVDEQMINVQNKNSSYFVEWIPNNVKSSVCDIAPRGLSMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATAEDEGEYEDEEEEDGEADDHM*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo