SoyBase Follow us on Twitter @SoyBaseDatabase
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma15g05570

Feature Type:gene_model
Chromosome:Gm15
Start:3945376
stop:3948430
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G12110AT Annotation by Michelle Graham. TAIR10: actin-11 | chr3:3858116-3859609 FORWARD LENGTH=377 SoyBaseE_val: 0ISS
GO:0006094GO-bp Annotation by Michelle Graham. GO Biological Process: gluconeogenesis SoyBaseN/AISS
GO:0007010GO-bp Annotation by Michelle Graham. GO Biological Process: cytoskeleton organization SoyBaseN/AISS
GO:0010498GO-bp Annotation by Michelle Graham. GO Biological Process: proteasomal protein catabolic process SoyBaseN/AISS
GO:0010583GO-bp Annotation by Michelle Graham. GO Biological Process: response to cyclopentenone SoyBaseN/AISS
GO:0030036GO-bp Annotation by Michelle Graham. GO Biological Process: actin cytoskeleton organization SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0005856GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoskeleton SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0009506GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma SoyBaseN/AISS
GO:0009570GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast stroma SoyBaseN/AISS
GO:0009941GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast envelope SoyBaseN/AISS
GO:0005200GO-mf Annotation by Michelle Graham. GO Molecular Function: structural constituent of cytoskeleton SoyBaseN/AISS
GO:0005524GO-mf Annotation by Michelle Graham. GO Molecular Function: ATP binding SoyBaseN/AISS
KOG0676 KOG Actin and related proteins JGI ISS
PTHR11937Panther ACTIN JGI ISS
PTHR11937:SF77Panther ACTIN JGI ISS
PF00022PFAM Actin JGI ISS
UniRef100_G7IL85UniRef Annotation by Michelle Graham. Best UniRef hit: Actin n=2 Tax=Papilionoideae RepID=G7IL85_MEDTR SoyBaseE_val: 0ISS
UniRef100_G7IL85UniRef Annotation by Michelle Graham. Most informative UniRef hit: Actin n=2 Tax=Papilionoideae RepID=G7IL85_MEDTR SoyBaseE_val: 0ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma15g05570 not represented in the dataset

Glyma15g05570 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma08g19420 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.15g050200 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma15g05570.1   sequence type=CDS   gene model=Glyma15g05570   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTGATGCTGAGGACATTCAACCTCTTGTTGTTGATAATGGAACTGGAATGGTCAAGGCTGGTTTTGCAGGTGATGATGCTCCTAGGGCCGTGTTCCCCAGCATTATTGGGAGACCACGCCATACTGGTGTAATGGTTGGGATGGGTCAGAAGGATGCTTACGTGGGTGATGAAGCCCAATCAAAAAGGGGTATACTCACCTTGAAGTATCCTATAGAGCATGGCATAGTCAGCAACTGGGACGATATGGAGAAGATTTGGCATCACACATTTTACAATGAGCTACGTGTTGCCCCTGAAGAACACCCCGTACTTCTTACCGAGGCACCACTCAATCCCAAGGCCAACAGAGAGAAGATGACCCAAATTATGTTTGAGACTTTCAATGTGCCTGCCATGTATGTTGCAATTCAGGCTGTCTTGTCTCTGTATGCCAGTGGACGTACTACAGGTATTGTGCTTGATTCTGGTGATGGTGTGAGCCACACGGTGCCCATATATGAAGGGTATGCTCTTCCTCATGCAATTCTTCGGTTGGACCTTGCTGGCCGTGATTTAACAGAGTACTTGGTGAAAATCCTTACCGAGAGAGGATACTCCTTCAGCACCTCTGCCGAAAAGGAAATTGTCCGTGATGTGAAGGAGAAATTGGCATACGTGGCCCTTGATTTTGAACAAGAAATGGAGACTACTAAGAGTAGTTCTGCAGTGGAAAAGAGCTATGAATTGCCTGATGGACAGGTCATTACAATAGGTTCTGAGAGATTCCGTTGCCCAGAAGTACTGTTCCAGCCTTCTCTGATTGGTATGGAAGCTACTGGAATTCATGAAACGACATACAATTCCATCATGAAATGTGATGTTGATATTAGGAAGGATCTGTATGGAAACATCGTGCTTAGTGGAGGGTCTACTATGTTTCCGGGAATTGCTGATCGCATGAGCAAGGAAATTAGTGCTCTTGCACCCAGTAGCATGAAAATCAAGGTGGTTGCACCTCCTGAGAGAAAGTACAGTGTCTGGATTGGTGGTTCTATCTTGGCATCACTTAGCACCTTCCAACAGATGTGGATCTCCAAGGGTGAATATGATGAATCTGGGCCAGCCATCGTTCATCGGAAGTGCTTCTAA

>Glyma15g05570.1   sequence type=predicted peptide   gene model=Glyma15g05570   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MADAEDIQPLVVDNGTGMVKAGFAGDDAPRAVFPSIIGRPRHTGVMVGMGQKDAYVGDEAQSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTEYLVKILTERGYSFSTSAEKEIVRDVKEKLAYVALDFEQEMETTKSSSAVEKSYELPDGQVITIGSERFRCPEVLFQPSLIGMEATGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEISALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWISKGEYDESGPAIVHRKCF*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo