Report for Sequence Feature Glyma15g05570
Feature Type: gene_model
Chromosome: Gm15
Start: 3945376
stop: 3948430
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma15g05570
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT3G12110 AT
Annotation by Michelle Graham. TAIR10: actin-11 | chr3:3858116-3859609 FORWARD LENGTH=377
SoyBase E_val: 0 ISS
GO:0006094 GO-bp
Annotation by Michelle Graham. GO Biological Process: gluconeogenesis
SoyBase N/A ISS
GO:0007010 GO-bp
Annotation by Michelle Graham. GO Biological Process: cytoskeleton organization
SoyBase N/A ISS
GO:0010498 GO-bp
Annotation by Michelle Graham. GO Biological Process: proteasomal protein catabolic process
SoyBase N/A ISS
GO:0010583 GO-bp
Annotation by Michelle Graham. GO Biological Process: response to cyclopentenone
SoyBase N/A ISS
GO:0030036 GO-bp
Annotation by Michelle Graham. GO Biological Process: actin cytoskeleton organization
SoyBase N/A ISS
GO:0005737 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm
SoyBase N/A ISS
GO:0005739 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion
SoyBase N/A ISS
GO:0005856 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: cytoskeleton
SoyBase N/A ISS
GO:0005886 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane
SoyBase N/A ISS
GO:0009506 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma
SoyBase N/A ISS
GO:0009570 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: chloroplast stroma
SoyBase N/A ISS
GO:0009941 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: chloroplast envelope
SoyBase N/A ISS
GO:0005200 GO-mf
Annotation by Michelle Graham. GO Molecular Function: structural constituent of cytoskeleton
SoyBase N/A ISS
GO:0005524 GO-mf
Annotation by Michelle Graham. GO Molecular Function: ATP binding
SoyBase N/A ISS
KOG0676
KOG
Actin and related proteins
JGI ISS
PTHR11937 Panther
ACTIN
JGI ISS
PTHR11937:SF77 Panther
ACTIN
JGI ISS
PF00022 PFAM
Actin
JGI ISS
UniRef100_G7IL85 UniRef
Annotation by Michelle Graham. Best UniRef hit: Actin n=2 Tax=Papilionoideae RepID=G7IL85_MEDTR
SoyBase E_val: 0 ISS
UniRef100_G7IL85 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: Actin n=2 Tax=Papilionoideae RepID=G7IL85_MEDTR
SoyBase E_val: 0 ISS
Expression Patterns of Glyma15g05570
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma15g05570
Paralog Evidence Comments
Glyma08g19420 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma15g05570 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.15g050200 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma15g05570
Coding sequences of Glyma15g05570
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma15g05570.1 sequence type=CDS gene model=Glyma15g05570 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGGCTGATGCTGAGGACATTCAACCTCTTGTTGTTGATAATGGAACTGGAATGGTCAAGGCTGGTTTTGCAGGTGATGATGCTCCTAGGGCCGTGTTCCCCAGCATTATTGGGAGACCACGCCATACTGGTGTAATGGTTGGGATGGGTCAGAAGGATGCTTACGTGGGTGATGAAGCCCAATCAAAAAGGGGTATACTCACCTTGAAGTATCCTATAGAGCATGGCATAGTCAGCAACTGGGACGATATGGAGAAGATTTGGCATCACACATTTTACAATGAGCTACGTGTTGCCCCTGAAGAACACCCCGTACTTCTTACCGAGGCACCACTCAATCCCAAGGCCAACAGAGAGAAGATGACCCAAATTATGTTTGAGACTTTCAATGTGCCTGCCATGTATGTTGCAATTCAGGCTGTCTTGTCTCTGTATGCCAGTGGACGTACTACAGGTATTGTGCTTGATTCTGGTGATGGTGTGAGCCACACGGTGCCCATATATGAAGGGTATGCTCTTCCTCATGCAATTCTTCGGTTGGACCTTGCTGGCCGTGATTTAACAGAGTACTTGGTGAAAATCCTTACCGAGAGAGGATACTCCTTCAGCACCTCTGCCGAAAAGGAAATTGTCCGTGATGTGAAGGAGAAATTGGCATACGTGGCCCTTGATTTTGAACAAGAAATGGAGACTACTAAGAGTAGTTCTGCAGTGGAAAAGAGCTATGAATTGCCTGATGGACAGGTCATTACAATAGGTTCTGAGAGATTCCGTTGCCCAGAAGTACTGTTCCAGCCTTCTCTGATTGGTATGGAAGCTACTGGAATTCATGAAACGACATACAATTCCATCATGAAATGTGATGTTGATATTAGGAAGGATCTGTATGGAAACATCGTGCTTAGTGGAGGGTCTACTATGTTTCCGGGAATTGCTGATCGCATGAGCAAGGAAATTAGTGCTCTTGCACCCAGTAGCATGAAAATCAAGGTGGTTGCACCTCCTGAGAGAAAGTACAGTGTCTGGATTGGTGGTTCTATCTTGGCATCACTTAGCACCTTCCAACAGATGTGGATCTCCAAGGGTGAATATGATGAATCTGGGCCAGCCATCGTTCATCGGAAGTGCTTCTAA
Predicted protein sequences of Glyma15g05570
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma15g05570.1 sequence type=predicted peptide gene model=Glyma15g05570 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MADAEDIQPLVVDNGTGMVKAGFAGDDAPRAVFPSIIGRPRHTGVMVGMGQKDAYVGDEAQSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTEYLVKILTERGYSFSTSAEKEIVRDVKEKLAYVALDFEQEMETTKSSSAVEKSYELPDGQVITIGSERFRCPEVLFQPSLIGMEATGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEISALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWISKGEYDESGPAIVHRKCF*